The_Life_of_-one_Vol_3_of_3KKBOOKMOBIc h%U.7 @ JSS\en\w0d "$&-(^*,ۏ.02468:<#>,@5B>DGFQHZ^JcZLl~NuP~RTVXZ\^_`ȻbdGfhjWln p5rt%v.x7#z@k|I~Rv[|dvmw%rs*^ x$$-F6?IR`[en9w]T%'OiZH o%r.w7S@IR\8eo x-! Ɏ 6 ہ~ %<.A 7:"@9$Iu&R([*d,m.v02K4u6B8q:e<>Y@ȷBDFH_J9LaNP R(T$}V-X7OZ@y\J'^S#`[beqdnfxAhej:lXnp+r:tvzxxz|~,F H&0{9CHLWU^gpzU +_$N/KpRe!?**3<EOfYblt~PVQrЯ+=Ds    " ,= 5 ? H R  [] d n x  e  * S   > R , Ԓ" $ & ,( * , 1. f0 2 '4 06 :,8 C6: LA< U> ^@ hB qD {mF H iJ TL N P 3R dT V X FZ \ 3^ ` nb Ud f /h j )l 3n ;p Dr Mt Uv ^x f+z n&| u~ }=         ɣ         K  % - 4 < C K T [H \P th }  p  ZMOBI䂍[40 ^P_a`[EXTH< j2010-03-20dJohn Morleym!Public domain in the USA.pAhttp://www.gutenberg.org/files/31711/31711-h/31711-h.html,T@ >>>>@@@@@@B  U The Life of William Ewart Gladstone (Vol 3 of 3) 7`p>TherojectubergBookf LifeaWilliamwarhladstone (Vol 3q3)yohnorley

include$t.onlit>http://www.g.org/l+
ԑ:׌׌׌׌ցAuthor:WPeleaxDatHMarch 20, 10Eb#31711]>̓PuagEnglish***STARTFHEROJECTUTENBERGOOKLIFEAWILLIAMWGLADSTONEOLP3)bvYheight="4emP3hxGBGw">oG*Inree umes .II.ww//Y(1890-(8)//or8oGee. &omy,PmitedCr, 1903ByMacmanoh1 <582V 188853blockquot'-96 >Chap0 (OpeniDays(RNewar1. 80أa28579Anpisode oleraTHw23120JMajuba81oo'b106167IV.kh@IrvZ277ύϱ64227 Egyp1ߍ145VPoliticalub e#2אOO249871 .l guNorr8ruiseoϗ79768Reform4OOor32829OX.RSoudaD4♿WW 8594 Irior5Cabine9G砗426052XDefeatiMinisHs May-JuneW/t57XrccessLordalisburyۊ'ǧw?95P<)6///W7)Lead0hipdGenllecϬϮ55ϩ2Hls)9wOO7819WApTMh (Decembﯧ??f62506:FallFirst7ovȳdJanua??g5323`wcĂ77_9679roduZ=BillWg0072096謹ĭ Atmospȭ σO(3P 6922Morrow!$i7oooooj81@AlnativScyAc888WWWW8015ך;peciCommi70ǿǿǿǿ=0000930517 >ChapterV.nnhim. (1889-1891) <(<>5?_=58IMilitaryosi蔪Soudan,pril579www'w6886Homeulell630ggg75 >O Placeftaly415____808NavEstimates1AW//ߧ/3373 >qGladstoneCabinetolleague527/53201ronologyǙ/>32366xFootnPs7< ml:lang="en">[pg ]Book|85woen!strikingharacnenchespposquicklycameoHdablLordandolphhurchilleadXaittleroupfourries, bParneaesolu0b၁Bthirtyrish,ithoxtousчso hisȃ8H`"Commons.

NoreapetYrul)weevHgoogeacab1880;kwhotrep9Xl8!eleAs1Zountry,ax[va ength.ԍgreat xsesso(l񅢅9esogonItrhti0;induA5sedasd8cla1ksyȆcilXard,yidHkeen-sighmbsou9rcIf،rankmanuaoilKc awhost XPspwoolsack'HCm heplac0cpeopěpePehelpcomnc×0lfutuP)publicoannbrokhnoncondes tyQKrarbu8,+rgffaHexpenEnglXfshenulibera@<8@profZdevoloyalX@efKiȏEZernp< 1LscfromRC[pg 003]}a/Adiv\Qur88objecDisraeli'sbmockery.tYal lmwr+Y:(hip akr aputh,˼ᄭ8fBz,Pmetimpؿcu`Xpupice6I0hGladstA}Ӊx8whitooaXT{wѸi[8vexa8kȼHZ÷apPd9𺀇Vseh󯈣aqTHnhar෱two8ialhspvdϸʵ* XstAȎQupeehP𭐖His񋲾#mXXiAtnt_᮳Yicoccas­!pp

Frommomenturovernzwasairundery,awndelatpeechesoutqslipЍ??/-C,cot،anK0Q.ǓFn>Tdorld,nowreXgiftsssuJatatȐȁownm.葐oneenseso,is* wheJhoopfo!PshllHvy.Uami`0maɟ''@AF/1

OconnȠaXfjsR,r.ladstwrot:LordҌy (Sep16, 1880)As;ooo peopl@1yass,riinestȫ5ubjeuouRs"Mpq;futu(pLooJyhf pd.ז\PliPXseem"чЃ0Bznabha0ald0eAnmpncXceed)znA.Ѓϕ@lxlawTbr0ƪa rerh. admdG'sVologpqonwo #;11wofulQ٦@spz s8had0ICoubY فywouldkxir XcP҆#IÂ?wy2inclu"pry3z2plcbetwe؜jIue~curiou2atoughwrmak!thrٖaeighgh0[pg 005]ua/ȟfize="-1">ChrsȖf C+ IIAllroughZfirs(wonthsftsuHess,Househow`signCndepe(kalmoxbrokSspiritministerialhips.iabout esndabb9duclivelyxci,wals Qdsponeasu;irwneaderin`geoldtax utithxity. S[pg 006]a/>(motihforocopwasarri by 229203,ߑ؈Lordar@gio;OnჅcltPYona oYiliatorppe@fromprim tdefeatI"remarkableВasoll!.ԙ8Prɘq,ntunath`ire,oPdhghisam asm1e3res`)eosg,Franco-GermwaHf 1870HkP`ourPZulul.arasko󂨌soЛ`eyrX8himAbbeAXd@bxtYfgaxt.‘dӗStaf8d΋Xhcd,eɣsijmajՌ poin8feel1s ?ʣHnotst!earth(yȣ㫀ȗozlobteficI`tryPhDp>g؛a𡰦cgrncak`h@ssimp ele[ailѲ0rel"BFr ShfAyIenXث@bMeanpPgoub ck9ѴhfpXy.enetica zYHhh߸a8DutQue8compl ԍ9yU`Com1rxecvesairepg P Ztfp"H#Pvas Amrovas1stit𷙖,l(Xercedb tPResn:roceed(Ju8,h80):div>...٩Maj yxy(bviewh(rciپ̄͛{ฐafacȤ)ӱ*exeyolllׇrobyq,ePЅ35JaddQ\crow?`LLXperbmbxadqtPesburg,C[pg 007]AnɽHpm/accouif_ZsiXQaշXt@dis(al@ڒ_bo ph@qw;@rpseemsypriph dum.đՆicengâP hunqu`:un')espe77p،G"IielYma᝱e8*Jachi薲succlju@fyI@ump3cheȼ budh 10)markboldEformxdayIexudefiostatqxܹhl!i_seEvunKagrزnysOO QortunaXenjosora`inah exctu8aknltiap0in0putRtr:icdg)wx#thZKiganimXranHȃ)malaxaAXutPre DQ0Pxehpda(ndoadİ e̒ +aУlcoholiciquors.verybodyaidhat noneutနcordonleu

Inڐrse(orɒ0seemQ(howulligx!؏HMr.cid`alpmwh@aembcocthjeexuptaxoHouCommЀ 1833.elapKn8hal㕨ulif2gre`arenaŽax!stPɖliaaxDhmo䋟Hirpsess⚰alwayZJsladleftte. xeacubL[pg 008]cHfront}ou8er-secre ˜Yly,鎰Ipri}houp.Ϙ韀أ|0e o`Ȣ)`h!rais(asaneP8sitt oiddlԧimf8ll.nnig)Lon@tedmaayefjtai.\P1eepm hjbeXHxalko,poli`Shake@8Hen8viii.decolo(stutxxnt$reasu`prodrespAfcoї{)9hru؟ KGtyastle䇫urntilept+4rdbk ,pokBordᔮ/div3h3>[III/`aorp0paЫ"I exp0Ѵ0bopAP,soPenQtַnahgoQvoleєat8mbadouwdraw0guagf apHcircumst1sai唈ct obser`ѯBeP ؞ʗNx+wsŹٯinҧcharar;pfHm+{xpiclomw1880,^sFkufporD}ᬡGPTMenoY(puay貰rPca;Ͽx؁وJt@abs0templiY mJXriyTurkeȔ(ym̘XhLalisburyhcor[darguihhhפ ect~qcoag8urZБdxtdemIr;#lban!cobehalfEachТan-of-warhrEupAb00w[pg 009]a/ԫǪ-NavDonGC a ,jEAGerydenow ,*fiahot.ƪ;X#:okYcourseiH@ialmobܸ0",!vi@Bish0bX obdc on: mzhowXй3u˿*riseacAsIpp༸¢Smyrnacemcoms'utiHsiXablePhi@arЭleCattarȷXightwayIl)Jho5h1 sk woȂdeBe`edarefullyllheilitaryesponsibies,nd〙deredrsequestrationfcustoms'tmyrnaoeracticable.ussiaIta8wriendly.ranceadnertaPwassum@specialgnisLGreek se,utidothingar0ular1omrdGermanynwashoped.nctober 4,SultanfusjointurډborRfilme engages`t2o!Berlin.his3d@atchbgnolcoercTHBrshovern:9onholv u!ith܍0׉`now".€XIornISundayC10th,͌GladHneLorxvilleearn(Bmuchurprislighpzos(nrXmbad`exinxC`tinoplth 'rhh]pPoH0caph80Itwosچ)h@farnglAg,ȑmi1give@b er0ol.As jsdi, aAxgdoubtmH`olte-faВؠwqsa8socomplncectDsix Xs;jЩre 򫑸hreචbkledZYskSGDulcѳJcedbyzPorMoIegroyַZ;`r"lesrd*iumphYIoicins[afiouegotiaټassдZsee9imp(ficJ/)809almo0ɩ)HPrH ea noo9`ify!2YPifitlum sw0hsoȆX%༡usory.׳le齙Mٜx0bhim (Ju`3, 1881):

SIncip:poȼoyouPtyg0ul44ځZtak@diplomacyIbipcha1serviwhic0ⷘ honabimcvج3lixpjuity./a

OnXhAfg(@i pQ|oli(gonmVwyyl色ɽ(aYu,ol$Pp1nHh-w fiInp@R)happXdpɱȨab d,tg(QhP8^:sumsoAypntuwкcludru&a y翐agEngxabul,inɿoC(aUpZymԳP-dhr(ؙTevacu|[samapubhoy8ecړollow!Janu(.HPa&l׾m8 rusgZa , PZ"text-b(}whorguػYshould1smprepDϹnsqsy16579;Comm!rridajxHX120񢜢Ծj[pg 011]a/3`="4emj


Smbp:pbkxh2CȿIInpisoXInԋ@[.20- 3)</font> OliromwellȂ/ ;h3DI<3OneiscordarefrahoarseahroughoJee莻isdmstr onnd8sXr0 hwehdqnfoPMr.ladsto`hadn seat.trewm8a troswasrobabmtastexف8nؐ4fo:cдlookxB abHream}Ѹpla)1pextremadvagЖ9ubPܥengѮ.amphletѸAmeqnoct(Hʊ9Hbxߦop`뻈YrigoshexcluALussfessedliharooHmoѮsoci5PFR!so#Dbeindicѓ`onqscap0vppuÉechn𡑨ަ'fusP&)jux`blYXla1869nynaf(ɸ`f"zcarripcipep0sticCS)(Al 29)ceiIetiocllaimtm1܅簹__[.3/a>ul 8l isH#ycpin `0ӆ.ϥѿrr`ٶqGladsh S0Stsc,P00curr儅y϶м `XsP@leמ㨲 luggܿQ8Jeymadؾoboele(commi(PTҀ|Jduppo齡`ȿxЛ~nga!inS(tп noePs Henryʀ,r؊ ,Hitbr@B h`:aHoSoeزdw 0hr0No:ad"yriu rgxrn:aN,Pmmascencڽ9g ti@rw`mxhowyumnatu ih9Xvxde0lb@h*`,Pyriepisod޶xoler8wȏmark j(nإdah--蓘_Xw S[pg h]a/idivl>ase4

Hhclaimaffirmxgrejected,ƒlaughextesiredswear.ԆYinisialipporqfeagainst IHous(asncontrollableSpeakhheldo(illibraryitḧ́xGladstone,*lawcers,n wothreep8on`futhoritybsensHe@؏if0Yancem`oath,houЋellow8in8ven,u\ca|alYdyÎant'`pderӕRanZ1bindГsciex.ostoیexp nׄ얰tіsworbWuggexit%Xme{piup:mRbroX8ڛassurrususupzrʜᜫtȉzadponwYuppdresAretuHfyagJ2(sel@mitte!P(a8akIrs0ٕ(defeahap9'qHped.א76mad؝g``o`Ct;carr@Haod(j좄[ƙeo8g­S,4debꯐmoattackOȯoftgrossonyo؞suchnYګXmembbPznforcirwrder,[unfjunbe(uL)toP(rchivalry3o0si{P0ИignoparcAtCashPpr8@helse캙charg kpaaˇѼMhusiapBlaspy,~QX`pi@SelbJmZpicuАpdevѣx̡#nglx.ϙH[pg 014]a/>飙iarli70`oefdayYounow,2Gcmp4hodox,wZ

ӻaiȾymgoHyng`axdeni@`vidQdo:rej ȽDexpe]xs s8ؽ󅛼s ;ұ i8ᲓPduo"T(gbpens¹m8#amBk0`#Ip*8ٲ `adHpecalaXwfewraI܄.solefyK¿m8XcepyH ,_Zw8l",$㋆ISii@ex=Ha_gislaxst q0rank bì`8u`at!Ѐean(uѣh hpdept`m)bod!гeun s0ssaᘭcar0bзytajq;jSy;rxunμ Z/00qCuraskѷټHdrawuptheologicalround;ouequiresoistinguishetweenuperfluitiesndecessar,Itell2hathrQanitysnefey,excrescenhasothoith:vitPsubsta,namFDe,hichinpensable.aykadoption1suaropos@xalveryootQronten,)aragqhighestegree9Aa. [pg 015]/p))OnhecԅsEvviewedaɁtH, 8dedёaembracnocknowledgm Providf`vigon!ponsibirtribu;tPvolv2ۀba8a8dmissormoidIa`p!meHᏠc`pZoushowe(, 8edily󀙗8owaci(oitsmbersIrgu*k(anyb. Ju21,r.ladstythd8ٗcngjqQu.WrenewPcuS,!wrx,temh]ž0mvXbqixᣡsuspicbppeࠛprevailydiff蕐quar@s.nApmadeybBradlaugh'sXlleaguAhould0 mitt)ffirmmetaa߁چ`2h&٫swp|TDMIwaȒc0܇4op65religo`ٕ8repliXirty.h3s੢ȰBX taill-defdXruđHll, HOsc0Ag(dWHyprima`quwhe㔮ju(di(Gtual2hopelmix>%P)odecl跀imsel/ H li@nt.0ow7[aurP lu"wlifhXbuhc(;zHuAǂɪtr8HUbusHss(etak7sP4ən>2VComm8occup)fromciȾullaHadj deb,caפКQPҝopinDڱh mfr ogNewdega,pi0t+Xu (v@er[ism#c{0dut(`dviP@bntang*ticultiɕ󄈤cha91ssum2Ϩن (`ss9[pg 016]Ua/g>AX8o'clockUmorygty:!(olvȵh275Jg0230KG@γ\DnH3ϤPpPkrd.oHpsapse#SHkxcR4um6Ied,_x)wran%ooec9icansporxnyp@sW! qha(ed.ȷ2ronadr9G0hdo!f-oxrashcP)eϋww#0mials$R dk᭢xqudstrok2rAgMidloaoj/nexay (3)at Qae(olp@y񂅰#Tױ77ayA񗏼pok#haiPripawe,octablh0imapk%qiu:

7hmay9view<:[pg 017]a/ԂɁs WWvernm tQN, *[s%jhd㺊exblish⹰isH`yurУtitu@seeټrh punjXQ'howep,dA`ippparw?k8`ScabinetAPmtyWwrѹ@rtafdrgȝ#roprie÷ ow塀aa8aoutuHкPpѸyPhbejudgmQsurI|angcp`fu@a ystu%work i:stanischiefpHXsib`ssShebackromvi"narrȼ`B;Al1881g ill0irxzbؘٮ immediatemO'Dm=mobcttleϓosfeth0ghAugùPyea}aЯ dihculti(ؿ؃ڭ2tisfaciIȫjpXeml8ue?һ+h376+0IIX@ necessapre蜠tagPrؙuggle:devp运exp {mHbdicajhysicviolPnh0-f%lawbyblic[pg 018]&/>w@9CЂϮɇ*xrub@camp^Ѿdhr@XrivalsepxRquagmsop Ȱ9c2xlÚminQ2hsjmarkhincinPdey08ƴtП3raXmpmad c8|SA۾bhbiographic becaٺ RafدВfxd hapIa`HytyX9teiarŠnthahr`llalo**phigZuhsp1occas wasoranyeasonsnef瀀tnxiety.ere rwohortntries,he)der`membering@byisimeJquestion !iyearld:

April 24,ԁday.H肔up*pmuAablhft.ɑcdeliXДcircumstance`fpassdicultrevolparcli#pugn[opinsrouintossuqpMradstHeful.etrprovڟʝ98m8,`fpXuas,ag(ouldvXeenrPw8ipt:fen;sil de cgCsoervidoftohHa(aiTowxҌrCtocivУncipwhiXnowsplayasp8viPftrarɪҨ0yȨY modirОflowXxqualit-'PxaxtH਑eirraosaifatorHsHm+FAӓbn`F d:[pg 019]^/دfoHsize="-1">Shn© =b[pg 020]=a/pDivinityxistsn>accordingohese,ustay,agnificentines//inem`ndnessibleYes;utith,stasoea0g,fπneed,relation.GggI@o`esita(atpecivil,formirig|which8educdocieH@thisountryou`vcontenArehoyoughbenruarȆblankism.ԆaarpveseldomeLfrequPlyuwouldeaHQ0epybeyoPviKngsworl͔Hȁ8shorЛHlifxknowzcAybbootlndertakDattemp:establisSptOmischiegP<7uch/pGp>THouthafewerhapsoll!rucretiordxـxhim,sxwellember4rialtills,arkenfrHbornPsmo0g8denc3hisa dduãTrislorhexaMgscomewncro8!nPti𧨤Rgtҁ.¤ampssufeHȧ1streasow soeffacbyoxigo`,narrܜfIcalcfw@Ili(bc`pymajorQ reĤholicmd]manon8鲉redXchampthpriv)judgm,寀ws!didڄQH.ӬɊXir0hڑzago8`9,qbodiخga)oHLximd@hP HضJviolhnhjzweak@dramXX.ɱiparliBradlaanasu83af)iereѰ1885emochosЕNt EHOfStruggle|pimm8oڊypdoPX8h ili@qoOabПAb fici84Chrn?ilepos=0001324955 id="иf_9"9~a? 22/ight="4em
sch݅Prom1078n>Inoundlessoilfiiefureensen!willntangleou߄/div3h3LI؇uthusiasm((stagheyvȎal)Pdim.hacceo8fichexpectunrsXZr0lled.;firmeeti8newabinet (May 3)` !ret!primini`t쏱marktosubntsY|k preacaripc؝0frjtoߘhDP,Capharli૘ immedi8ahxL[pg 023]%a/aXpliaPp.CLJnʘ e-rc:|תWfweek8x·jȥ9tq鳪episodlpp,brodownлPXhoinh rafeoQuihighms4royHs൐ot!d𠫹spi`man߹؟udeKe`July)s׭i҄Ocas@9suixi¼twopllowQcjsromg]:Tn4A28,r"humqduthqhjonibceyMajesty'ele0es! ..usSaturdȿbhfXhram𽊙I disal,hichi@werfuHo(memb{lr`s@ѫmP`orYg:#oH@HqpeUHod(eYT(0Io]0M8whe8Jhi des sPcnog$gyadvisygXaNs !7dohce02sel :LionhQrerem seemdepup𺹽@litym1pXmatyok;(agi18qP1ountYu9xampPsapyɿAYjsituntraaB-ИmaЎ weHÊ0fatyknyurgood__n>a 29ggIo!"iff"opเamAАqv,󻀿xab1oarrh1lubr@rospectfrogressnhe hatatterconfederation,isightffordၘoundk-opdetweemSir.rere,otwithstingstroXcensuhichhnyYJ8opposi"hadnced
<:[pg 024]
upц@policy.ԆHclusgavejliveliestsfactolargerˇhaps9majority,ouseCommons;utymbrat orca$yourajy'8armegaxOJaentim(some0msonallyhare./phpIasvid,oweverـ5lnat@castha‚IcQusict81farroȔeablowho,opinMr.ladston@honbiheldacky2mdself-:aiXȍduYdecؕhimgriXdQus)oug;cabinetHd*bcould`Vi(irmyrkmakeso.’Ktalil1dindueaparlia▰movpߞyp oviewha uitndefPtalmocertxsr._YRrepPfulisubmittzo70@haCۥ8os copjipielegramyr(ll /div?kh3lIIǼiXaloCorga8ѣiawiЬpay0Xmp }aux(fȜÓexfozXmepossi8ul:syatu3pe Euroo:PS8hfPa@myiAe8ýQusetpdӼ#)Xesecr!ruo,fsink@HPɓВarroiѨDpStre8Hd (Ju21,7)pssumpښsuj)numbibi"e baubjectS۠㬑wai"Ơ rsa,seemj0hhrobIIߏTmnmpim'08spriviѳ ٬circump5cptxlipeo.'0ssemb(od֐Z)n9twjydi(xdispu@A9= we(7m͔KerrepaPxYLordarv];fHow-veЫ p;7+ehLr rsal˝3ж2Tr,`rong迿 rd8pv kThXngfeelfodepe(,t! preparedeekingheestorationfndepe(nce.ԁsignatu@ereoseYqualifielec(s oldpublic+government+informXbyirarnetolshyatabout 8000ersonfagoe6,Awhom eȂn 7:Bo@o2peti$ap"dlmostxactlynameщcolonialficicognis pposڅannЋwasr0icalPunanimouNm؍0ve8incaadd(ssid`r`atowndigg popul,ichBXstroinavoursup0sswoh,ᒲuragatt.

Foranyonth3qeedryPKrugJouberongl ;ye`h@sseHngs; [pg 026]pPyhighmi:oack?ceTmemoraftЀ~secretaryYstat Iautum1879sudmiHtןiTransvaalH8u)oclam3set! th"wileȂQueeY"is rixhou8be[|cinu( ytegaP`doA`S(hfr(clhday ootXaM@aelickseachoaucceeCarv(Jan.8),e0ds!exsirehe`detRXhi,ŭhtF7tt˪Husparangmood11/a>8PgНseemZ"ɾ19*seiҩHcc!Hڣ0dX!xitزry_decijOnar9Hhap0IhٮQ۽Hli`w@mapubxwl1phqnew`0rP'p*t0wrؒ TcжaѤऩV1P9a^%flPback⿀rDr9sberc|Nw0drawƠ;pictu`pxgXxdsoG h [pg 027]n/؏!divɸc1u ǁ"إw,ordȫHlep,crrdoct@hbehHؼ`HȼpliminstаjxdEempire,ookheransvaalornllustration.tasowoncivelyroved, saiHthatargeajorityf*BoersereitteragainsnnextT)beingo,tughttЄ)sidHdhsettlPquesybecausenadakenlace;Pdfhouldi2balance advantaQinavourro{y0epe(,plXsenxdignуstJnbway.r.ladneyMidlothi1be(moXer00ictmentyaontwo thref`s,JthoxcompaɏfugiYRsedaryёisticlchᇁtALgpeecheHboura oryhhahbEuropeHChrirepublici@climitspnarch`ghf 8000ؒ(alifiȓPvot(65Yhtitra?Akǚauntwhacxunwis,m`mpsasanxRrvH4n(p(icaqE subjeco0chЁéympelapoccepQczhiphichyyecliȜ88;`sTdmxA@ce.13/a>Ird lettale:Ifypru:eT[pg 028]v/>valuabhX2eles I"IdiatmFobt{m sxnx⒁8c8􉮝QuY9mixy(officichie hpaleaeop`ЬxllҰ*^kyexgh.

Onɰino87vernRfH eviXeff polpczpў?e8dimHmissHadPogثRunanimous.vȬ+ah8qwho(prozlikmXodB8u ,ﱂcquiesc, ctY3dCap(olonyʹyCjifboB `fa8tr^HhossPnH cey? gssuXtXfa`⸰fec0ssh xv@waM`7,irºH8Fry4eew'XarneP!cr!re#r @netjque@X12ag@dPKermTtgram46644>Q{L(imberlᘉm|s eign Queɼdz0repshed,J2xhopLeضбrenJRptituaryi de.ɍ"wspihIћ`bdefiansaiHxH|o8usliM`&o opl`mselvܠt-h.5455(shhissu v(anguChaڨٔpionthIЄו614166WwmY{[pg 029]a/>ce,divD@ifG8pmobligRsJ(t eԄyo`dn0veXc"؝hasK nsp֫؝Qusieignɲ ndesikYinZhhenjofuli!1af0ȥW ԺmȻ mpڶpmeӾ?c0y8H7SolemXdHxX{soundPntep JQeffec!@ۃbrrkI5Qy9ll.Xxworxlx "m("tback. Уiginrocla i῱N'legislzivg(Xp0bcircumy=(ݱ9geRnj(Al`77SBartFrm緰s@lQ o߾rece`BsoXWQre!pɑȒlarSع-wIѕlohpca.<1lepos=0001326229 id="Xf_17">17a>BsecretaP!alsHpocsS.uhri8xchHnH`adӚs earn0dpRe'[i )0eeȅCėd8ti!xڭ4oIiiapeÍ,alprsؠla Lrown30788>mhHatte8z Hsdur:begmu`mockeryʮhangnhaid$hiuఘt(.-w*m3frenstituzpCupp8SH8up (Nz9,9Чo9pBishficYn8سHTleHfiaBȌ󗪆htiؗGght;ivyPb [pg 031]a/divis19

Tpvalueuoffalssurancesomgennspotatestoindepe(ouldp)+chfeŒ`{giveuefi(yagit|:peedi edprecÊulxflowjPy߅. idoerersrkxsoucsful Caparliama{⏰avouritnaceaAftyhuhup.ȎЂt puzzli knowhy Sidid `8Ȍirepszb`u)T@svapɗeyewJroad;with:excep5aurbul d Jƃǝ*sigh9ornjoyL;paxxannica,rrevshhapx beJquYtruIny هcwapabluHc mortcowardTcZnrakx0$elWhkd٣XyrxaijDownStXt,iodsbroouccpeaxeStiS`Ow(L@onwhoplp 8lMarch 1879HLordimberl:nperыouar (Nove 14).j1mh᪰Е5suPcauaanxietyec3sI0t0sPbȄPltaekr,cla ۛrepic Z@.ÌyXrdǁWolx grn෸NaJms0sh-eaAfr8`}litt8@iˋAuguЃhُhuϢWgarȼ)/-956/)20-20/>[pg 032]}a/>Bghca?qz9himpf (4)hruro藁-޲n Q{gageHmedTgooa8XxȪpjbagu赸ish t@fein^.

px؂rmȞ@r(ciX PervbetwFr's)a近Xb0k2ɷhcsobٶived;ߑ7621ߑ11ߐYyhQg8n;9qexsaXCab0ngtimh nүssa诨1elagoaaynsh(tPҝHopso`PugoqifCؼ IKغʷ%urv"aewsoeardopojȑH櫰agn39lo8unwisdom/div(3h3KX wq4lPy1Wh hYju8ȿadayf꺈un.embersfheegislaturetCapergedBritishovernmen0oendpecialommissionerinqui0report.ԃxpolicygivingnsideratɄcounsel.Weadsuallyeenursubywis@headscȆpinouthfricanffairs,:wh@chiefFreetat(eA؊qsamecy,irHighthoulderhaps ved sive.ordiley,owe,doinkmoZopune (Dec. 30).22efoPmanyekstppe(`onnde`t,utn((untilxisI#ДanwhQu'sAech 8emphcaragrapnncꖌdutdth@Majestyao@yset h2tiplsecur `EuropЁtl|Transvaful)ntrol Iownocd.eldomsnKmaPpieceYhuta`؞hprtsed.

AgaTtaroshpaewmeab0acFouray8nj,re9BeآґarJJch (Ja10, 1881),assag8opIqf:b1lastxla8orxf`bloodshOJliprovoid frarm0!s(W`āpXmakɩৠsforyܪHwoC42)TtopӗI( xloss X (sPCJusHeilprs)b8Psű'(topcorScQfiniв[pg 034]5a/>cMs,i 0cious.6F9welBȘE\s(ssOn 26ecreta(siٻh H*T,wӱ8Herculesobins@offerm`țٔ Cthroup̗hxc@A뽣8pur od_*sugg迩xtrucXɊ;ziXůhQOL qeeav @frsuJx@be(fyfriHs"Quyg%omptadviin2ʊغh)HSOrgRbF diffit/,0a8{9.nhhiLXy鄄 BXish&0ulѼLHgNek.àey,W3,Jwt Jou``l LQadir #*larr艺ivEngH8pIXaàis1fo0spHwaLr𡱱gvys.ɷhaBaelensiwa2qsP( @b3tackh28)Pb b1whoceedrehXX t`ssrrmon2.

#Rimpunѽ, n(0GeȆdu؝ ߘkHƏuatetakubma ;ɞIs |Idells8xKim*\RIxninxҕ![adbhboyw( 2rxس0spmnPabousdHrطѻZMGladpnɄt (Feb. 5),Qru(en.LAHvexI u9!chi ?٤itdR)leXrowilȨpڠ.ȷȤضuXwȼٳw؝ycreta,ib)ck-rorigih0pladirecÝ` [pg 035р]

BoerverturesthatheoXnme wouldeeadyoivellsonabluaranteess)txt of ft(submission,fqyHedromrmXopposit2andchemefraIforermanifriendlyettlnt.stappened,n"dayYwhichisdet`|Downingӆet,ollsufferecock Ingogo҉Pr (Feb. 8).etsote8`Xalwaysag0in irgnines ppptitude militarrome.Thenmioklac)or0 . Аmairprsx,.t a쎈KruIXt12Itsurfairummari1by-teleg`colonialreqpithxazl)![woȈ EnglishtȒ񔛈 sipuynxm,ۙʜ뒀ea*sulinquihaoycomBʜkroopord wdrawThsvaalhotimX顊su8afassȐ ~Ln +3th<15broughbt.MGladstonmhia q` Que5)sviewalikelihoo`fГ)Isanguin)acs,rdimberth3vXeipR3\junclrmd⬐,ӧautexamezfdAnypZS$timsIclȑiwardsAJ@ #decihahkXup,Yta񍨷0PiHousns qBri1ChaJQiC0ishZ=T,Pbsɵvot(Jct6(o,"ȳggs?n[pg 036]a/>idevelop ۶mean``x(Praccep#Vr1xo#ag髬sus蠲`ho)eРѸsunȢIndyʹ\__\9193_Z4^4_>ϣ3sIdahh>hfiؿоIR!inv$v! epX9;didisQbutw nxiRyouakzr g21voeffu=bl.̽spir{in uCzc8Aekr231show unxӊrYil9ӇD>Yo ۹stakq@p+brɗe⿒[fii!aPH`H(r`6Ͻh,w`uzzlsknowpوId17fgܠbXP(㧲 askpuex9)nRPLgpN@(ȹ4NatXory)AccupҦØqg@i soY8P(s@`ъyoky?xreliK͑inqu t si _#)dۅQeӅ溹mselvXApeacefulscall;X,KiPlsL,goj9h))mardfA1,S9^ceedȶFix4abtiansusP`򙀸1ȑйؔtxwcu[a`%.Ⱥdduuрponhisroposaleingccepted wi(norty-eightoursromeeceiptfletter V/P Ilinvhaalamity,ehnbe tc,ccurred,rivi Xaarye,ut midableaanyeaH8comeٍyissumor1ndoApxatta,pasُwhichIbecaarnwatchword.nFeb. 26,olley ɏce359elHolmadepˑAdifferecorpsrchXopppi@l.ԕgene')tivdecipncyrbseb@xplanatIseem xAoepusPgradu0ywarP`dvgrounhuwell,ywaxiKrugerreplsehlybetweNekown `tpyosseяwouldkeahAun.ȝ@rob@yxdoect mov`Znssaripleaf)Pfawh˗aw†܏EіXfiryatict bego tip1წoxchangiinds.<ile=0001329649 id="pf_26"26a>bLphe0byGrtZhab1rash;ertepstn `tahimself06ndlushow(de`Pؔid Hbclimb`ad)xXhtdxak!sevJ({7)lf-(lysyhlosک,yihcr1ˠГHadysmQ:P9(mo=um,asosHicm$mrywho*siu9disXpalhRifPSipe@oaIasix9pXPrHZp>A0оS٠fѬ3hyq´،bbuaAffic0,ǖDWoodQC`de@Fhr8P(nnglu@.r.lad(n$cagh@a񺀰zRx.=cC8!echnYaagfȺn9 .26thЛ[pg 038]a/>Cppoh(0BЧDD ju@iJatal觱lb`erћ}!ircumsɕȿXHxiggs*!Idefe(if`sdrawّvi0osal n?פPmirriagPnognituitQ1urdebhoҐcelibeqdopywI#p`rfu#decir2Su s0rgu!s,>LHˬqr}ninewHv(Ma02)34maXunhPttackH8spxXPhndH+b`ٸwayXfHofrie@yPpYMixn`yegram?ɦa\)mayqagis;ifx aw؟gecaqS,npeddblA@HHans`4X%)3byrugtelggnorBy Hafhll-fxdth+meTsva`黪iC.eclHsCtdؽZǣQu!incl cxࠩiep(qÄxop`͢eetfhvb蹈dw*baYHAspe+(ulTٖS8tcٻihi let21camentoisands (Feb. 28), teachedolley'successornarch 7.

Sirvelynood,owfterheeathfthiefomm,0roughouрendmilitaryction.xnsideringisas8se`d8staine tght*happiessultould)atla=fulattle,hihopfi0abaortnQeo peiqPnyuarante yȉfieagHwilldilye owHexpl↛byydidteaYɂ8r3sxisixIpan9caffectur'ptigb8BritishictoHenabЉe [pg 039] div>rowٷ+]$ gihQ@ymidablx𒡮ɩ a.<)lepos=0001329791 id="xf_27">#27M/a>qPnaL8ɼ*Yvg1fieagainP sMajuba,orHimber9qwri(Febr24),MMy efehbePl!s8"par􌱾`X0veRclaϑͩ0urlln msavou alamitU`rBpsRa@po ed׏967׏88׏p>

TmexjQuqаcھcabcnews[affairs:divB T;.FS1881T޷Zm!cxc"lyn1 ( tXu`y)cnsH Bopl̵alhi eo-Soဈhem.heyeltustifiednonstruingAoernsw9seavwaypenoZappointmentfHmmissioners,ccord{telegramreviouslyexandarovbyourajestypnxkeepzqu0oBthisirecɄHundextremergencfcircumstancesɇ!ime,yaveespatchawhSirvelynoohlMr.ladstȂHlPsdxllelthatZposal%soKXJtunate amo0oxrro}invola ogniŽȌty's <:deactoauthorityervaal.3March 12abinettermX؎obvi!ؒ!ehenuspic"𐠍c.C@in(grnrfromAquarȘsuggtxaȄPce[pg 041]]a/nam8expsirPdrawNekliСhack:s rgЇzrgubJQ2Acyrefus<Ȥqnet(,alඨtHhgXЕI ߰0Xay.tlaweHoLorj[pg 042]a/>ee2Ispʧ;a/)xXpicu"yerisps!oubh"XXsurfk!easoBnd,becaa ,3f0 rng.imiҲifo1urig(gЗ ૡʖdfirstatEuea(Pch-loټiadesirablJAR+af(new-fhweapoR񽀜hediff soi2ú8+wɳcarhдHubarI(naPp),rtab!+`ngal(xdȵatjd?ԲɦA)Pkiley,' t@Y`b[th?ϘHIwx Mr.ladne'snguXa*Iڮ>Alwe ဈmightavereatedithoueforheseilitaryHscarriages,eannotooow,ntilofferpertainumbofictims expiationloodasPenhed.Ղ׀done,vethingshich believІo psonabl؁^we@d0oXusPzrefuanЉ8ustait,Molo0.apped?edpena@or egot;ˋhcloag,8caa8ndfulou*cesrashlyeiz*po8yould(old?ԋaȌgBoer3kefensidHoCommons/{munjcruel,coward!meahacnt(xr@ ×oo kwُѝ irȃN/ occurredal;declațkwill(Ym und9ke.#29/a p>

policyrhrsaBexisike8remqahpicyendlehpute.ׄ748ׄ3030>sӔXHercuobinh ȗ|[pg 043]>/divtC(ed˅ʆtwrه͑ȁbgipEback Bl``xraᑨ8epoȿ㫳ex0p(8ar(r8דdЗY˛OYrro(٩ोiirܽǴspdym맹W9waPason[plpgHr0 worP2a,tr Att.iahl0ffbh?J#simpunmik񱁸Yty鞀,p ԹMilasrhumnssqmixdi8(h_sx8eဈointyrgumentshaelongonother,llombinedproduceူnfusionfin!ertainchoolpartisansaveradpupeverince.Ӏnge mightyatssoraYwardice,isguisasxRomanidPA(aydmipburaxbinister.orbeeeɅn8"bloodsh@fortuelyppeЊccithxude苈dou0policyst.

VIThnegoti@cr,fߎp@rord. BoPbXa8werfulrihwampٌHfrHinoZepressdxmisѓermsIfin8agreeɎȏhfactpIeafpyllega؊impo.͏Gladstontc12@l(nes#,s(riQrQdousoafrel,liaarydurŗst brrimߍ`Xmaz.h8Rox-ɚg, hem+ion3Yunshorngth r3enablngl!caa`HiQsursvlXHIff.EWuld(t,aiLximberley,carriurԣHsvas,l@h agnAhsomHotuch,a 5ayqit.A@xclhxtretoriaYS[pg 045]a/ ɠom-hSequelcp>AugusYecogquasi-eإ,,bjectzګQueepecifY rv#3Έ1881ʤkmolyfaffaiUcusؚAaJ]!Chaڵbe{spokes\a`estyea maknspicurar mark8gʧKrugLod(QgXouPcaop`˙Derbpcy2jHifyfrb!.yrKύ4ڛ˱BHoȯtit輴SPhfricRepub;rx_ᛯ~arnewe;<7>T..ǂ@n.aile=0001332781 id="notf_32"432/a \div> <3h3fHize="+1">I

On*dan 1880nordeasfieldasXnallyuitt officialouse9DowStt,eoada0andoz8uppor؋hpolicypress,@edoid8mood-bye.ԍvisitoralk@gloomiЎ@natio`xospect;diYultiesithustria,sRumTurkґIfusscomepEurop@romcocnMidlothianf(s!l9nedn 8katfriend, 8utqd1deepЃangl. kIrel!LisaidpIn9peechdH2rhladsaut;a(HCommP:governmed tat"0ng n i(yʜx2any؉!knyfyears.׃cYtivolu)evmpHeng!p{PnoashPurheekКgrowaler&h(t&xk,i@grapplGGÄsuHfoQ٥pre@suur(Bxo҈w1a tJ"es ce0ve*QudutiЫѐǣpow@Ʌujleagueǫǫ888ǫ33ǫp>Two̜EdinburghIHank0admitɨmmy`ndnnPy[pg 048]V/l+j|O9alequ`ӷ١lIdY,akneh9s9urP9al@dywelZ horizonCrt f9rushXblik殐!770983724647w>Sameg9d(nanIffai*ctivQarliмxhipchPo8Jئ(dA/gSiorgaЫΐParn2b`yǁňёhP'ȏwnձ/rxd?1viopYdra"Dulcighssaly,BatouErzerhԘi(lacniarAr`%1lӼCaughMun){ayo,alwahSligxKerry.riagipҧcɡQ,7tap˫Dٓ"p@qeasq)/d0aНYsruEgarPIagw4ϾoTٽHmidabslowunmaself㜋heЪ pFormcabinebe!alelaw!@exceplcs?execHvlap)aȧywaK;8HhctnewŸoub!dixXso0y*ϘOhhncertIevi`ur)uP HousComm9biȻcompensH" e`xdixuX1m !آholXg;iлi`frieP.̃)LansdowstirmoBreصƹkY)capl0fuxn8iahmembWQprof d:9XmsiyetfDuArgyбW#chur(estXZuluwȾao0a߿(ҿinclu901 #[pg 049]/pټq}-xصIOfqs{]upri"a2radicalsC1Chamberlain.eforeheabinetasixonthslddukepluckingr.ladstone'leev ithomeivacitytBirmhamanguagenrishd.Parnellnommitteetab@Pdromupport1measure,niberalsotagsthirdeadx, JHousfords,AwhichationaliIreadotበnglexpresenthv@threwubibajorH28251.Ɍ4aiifሐ9oxsiIeersywayt)P@ wou habbeat9yirwn5.

Loo:backpH0ȏ ntЇ)emorum9lxrearhzdursessax1880[eudgg himXgood0aoo,ؖ1orHgqHAignueons@afhiscclofficdra02XnɊ LAc(I70:35divBLca(cispdisastr(jecZkߖڋȗ{governmxRhopar(progzerkrneڠXx%sdirP 8si(.Ⱦٯthحdaperrbelie) \nlC}gew8-iniduP,suspBaPsorpus [pg 050]a/L.wo8ffarose:؜`"w,d;dlimeؼq|wxiwc# g(PXa`@ؼlaw(lsz g.o`BrChal@,IeB*,XQservta(5h؅dpٹcipiur obiWhhHSargu:exhatlF16566ż0erwp,ө XuppofromAmregarUskAsr9hd9g8sncȝlX賉 be0(pulv[?mowh IЈ0rlliearl@qythcmyy7ؘ rr@d ,XcD🦿@,WaA\soqbHleH妿 m8FpлQؓs.ggb377gb7f7g%`l(acquiesзHtHأwhy?ya+ha0brokup¼ןvolret.apz򬡳I`m"pecpmX'ao cA!gigșXun˖Xspir''Bru8ԿIworkRiyPbefuÆHpѭcл֒ǬشHuա !ourhighestuty.hereforeubmitted.

Byindfovemberr.ladstonxplainedozQueen0atstateIrelaXwasenacing;tsistinctiveharact8Anotouch@generalnsecuritylife, ؁=aidespreadonspiygpxproperT wor0it , aid,OlHerunlike'Connell,ail denounc@rimeoutb0kcomp0ble1832nH79omic x 64242 arliyH!Qurba.u0$bHgh. <[pg 051]a/DsiXiedxlc0 po صIoi*,yh(himryhemp>rX)billiydesbꮸc enПQvicerolocRanybod0(poPloqsOЯhlC!p 0`a>Jdeboroduо!᫸dȔdaygʵx|end.ȯY'r'إuwnorI  e:ӥpMonp,ax31KaHxboi9gn}apȴriumphn 0GǺ.,iel־(sBfr8dmitself wiHsɼ8(]8tip 't0@8itagՙ;KOnuesarXw y-fP aIplhhampX8FwvwoufailParnxC@YhnuR,`scipeorgsڹjgifspeech@leconheituation,ndameoconclusPattasyuty1extricatXHouseromdifficulXbylosingebofaownuthority+sossertundoubtedillɃagainstebelli0in.entorr.. xTuesday (Feb. 1)boutoEtoldiQЂ(houbereparX0p)q!npiobstrucŠollow9dis: 1.ԋ߃rriȌ(untilGBmorn,Rbjec8yis0lbeoark@nctlsideore0gravuO neces'tephichaake. 2Tre0 rrregulzbn,i`rAgivďؑ, `onfe蓨OLSper.

mmund8'pvalintصo;(Northc,nol9exceptwh،ivhmu.tȟ؂exЉ(@]ΠxАedߤ/SHSmeaMJanu3Xr2mK᷉ll8ud𶩷.|nsw1,UQay$pumoՕyacȷ1wspbil(aqduǚnevPh!8lou(rCchee,xP}hanladst@.Ԛfirm !inw˂5hpuVuianneYunwipeyXom"pKapvoxAq(iaXim)altW`h3IVoImxi@fЋ Bl򻹝(omit+s!ou錟`9QPallCnotarroxjjid[pg 054]a/>+gQi b(w0ʻ(h HaI鯧bey`kӏ0`wbiHA蛰r@cIprX skA`` bхsл %an.wˆɒ଑(otL YwhigqeBCradY0oub9͘ѝؐ|09Qnciruؑerishmen,henheumoureizedm,adimnilloinerunks.r.ladstone,s @bserver9lyays, fac(difficultiesuchnor[ofisountryeenered,OIpoliticsᅸ7lawrincipleetailGFarty/ersonnerυlasaZonfYovseemAo,nH@learpmmىeuestiop4digniauthorqJmean@im)iay)acceptingdIsugg Dfirmnesnesid@ructive"onaihXograspfitApyetsrdpossibappreciatdequH9embarstjsit .

Epghalreadyeailegisl1870;iabl{tthat{ȁtubjecanhvidownhiput:.C39va>ԡ0axcauseihao yx4;limit"s;dminrYpensotenafdpurbawhin%;dzfixӣivat0hol).𖨑iwiedeichmoCi8stbeydiar虁r;iXYsettXgrmpnoЋy߫٧zs;Lordœ`borddpHx18811favA)onrb a0ibunaqy{uॠrigh+[pg 055]a/@GtriLaw[pg 056]il,hatheenantnew逘o
fundamentalharterfisedemptionromorsangyȀHboge.neasuringgreagrarQlaw,otnlyyarliryorcendegislativekillpower,utᆙvasabiddepthitsociresultsodirecstmoren,anydisposedigiXhigheplamoMr.ladstone'schievehsmaker.

FasometimesePo P introducA1bin2sessy1880fchadd,argued,relwouldZappnooercY7nec,whOsX@rousexasperonmisfPils)quarxtwEngjQ͕tll d.riticism#Pkverlooksreacts.e`qnpFya!Hfoms98dyYaccTF'Sec,BboghmHyYtnzevidencmadysًreport.Hir ٕsHysyParnellY8probabdoBc"whole$policy.n AanAe1. You3hd,#div>IRp

Wqr cBParnellism,houldoropoooraisevepqstrongnunciation9YyCihim(toge:fromIrisheopl{qmas^ members,ayhoruhasonsimsIniewwxf0s @,-!ہjFors9nest(April 12, 1882)Hm؟reasonhxllu8IpŤie fol\(8wneYMr.ladst'indχ1Pbo{,dꋂ1abmselvePsu8henYe(1.)ntwXsxous iXodiAe zu afr9J0,ɏ9y nngzXsx0bpdemneجhb؁a-saiPCbHs`,qLj_X2XIfAbtYCitowarxecu[wheakwзbp8miЎ|totqaEn0imțic(oعXpea;\OJ@canc•f-W_3؏ؚstȻ;qu lt׫҉ fXiȹVwѿaʟptngE!؍ o.ɓ* alHy B,kڣ[h)0;xfHsafS2doct wa(Ͳ Ǟ_X4ruxy(difPH"o-d ioef𗿀 etweil[enxpi@on;nex⿀pihǔriAjnormjdǿun )hqeopllhopelyHdi์"ةgi aarlintaPpiShPeX0nyѠchief [pg 059]ua/L)Abbinht*s)7 upHez#(abhthysis).WLbee4adiÈj@ro𾗵S`em@׹0lem:dةrdu)v} legisӎFxex)n.ϮeaderPofial|skXHgunoڷiy9tspⲙLAcPid0ЏutCirc8wire-puQ:+bi;re;TsuZnoX9e뷣allow)keepIupag{r4afҚTduli@e.H[Lturn;*as@WfoiKoSm2ɺsRRWc#xviejui鼸8pP imv8crim 0rag,ecoȻ!@mpornԞh3VI HawardCastle,ept. 28, 1881.rough/ cstateMnumb eameeiHrequZenabmjurp(wHhall{PdoLwibixbyspeifficultyuneassth"incipthofЕpP%9exhaulInowaww>prepinaryaddiaAيϟpowPv[pg 060]a/@iZhi*s XnycHaQmnnty-two;Iۤ)Ar Ȧm@occaYelaemolHontracnidl i IX1PСϡ˫@spea#YlaY/fJsome 2woul(ertain2desirPCwg(ۯ0noyhpH:1kXtUOcsh›Xzsorp`"oppPuHi0}ublicȟse;ҟܫAhopwɸ)mightmeWW>afWWhec) L77>s??H?=8mdr;ܔfrom js!c([>E/֠ngaCaud Hby+giArHtf͂8PallIfthallppearhat(erestitoeoughtinalonflictnreland0tweenawn98eide sheerlessn pE,f purgedromefeX!anyaintnjuHcrepell refused,Jfirst9ditionsYpolhcsociet0o8mXnfulf)ay,entlemen,ithoutesitaZPsource*civilisg8@itsnemi anotetxhaed.40/a p>

Noraspagea@excitIt.Ԍ1ongpeechhichyyZusQgremameetiaddȁ=chamb0IommepdevFdestruc*(aeomicphirsripuahuHDIvampifree-trI9idiouslyuckє*ife-blood country^ɗa8rvebroaP(facts,(p2dy horfigu(,wsntifxaysiHsH8ȗsonp,ynev0`hK`summate t `guhvperformanhdid2sla(h18vbHdro ؘؑQQi8Yorksh)(mhi)oYe.ז95ז11ז/div3h3ǤlubtXt`rabȼh"sbyarlidownllaruffians;bأrlu1arxgh𕚂[1w altoge{!fB,4w2Jg8inz, (iY!yi0wQuiSt@cX@vio/Hكrk'!lookjPurdPcRyhelpm2Bsua.Ȭxr` (Decem 7th)!ClewIbegbdefXxict2imi`hppeal.askourhcloypai;ݓ)ځɄwpyR}mQ|,((ha8m)p Plpubgsurhnvel!ėб1Stнsta bHf,grh`m)quu( edn 1844Rna0ab%o nhSirҟeeuȽ O'Con0sЩaInkʿQP9GregoryVI.Ӿ0er` iscagiKؼ_Xyanow۞"suaͬ2.£Qafcaarsim$e 8@hc8ihooBlrserm8exZRض!ĝ{_hibQ11iilay@ȈysiX@auttm!oaol.eedotescribeheentim(sttered.ourminenceilleelmndudgxstronglyaIo.utPwto:Supreme <:[pg 063]PoffRhardsurpris`whensayPatreg@im,fpTofbfacts,responsiblorRconductlse 8ests.ƁI놑perfecthweŠ0hQpmeansysiling;)nynemXrenublicdisputdecree;ul1870 plaindden9la8order,awouldR"/pp$Mr.rrton,hos 8RomeIliev (seaPap\hopDbrought1far 9ɑ܋le8h holsȓAhQ?;`u؂9 tion.ȃofficialrvanban depe(n:catyc@le aolunteerishyrelAZzrُqq,leٞhqundbhichgieardqeڠ oajKm\GPys`J_b!SoyhmTWfulfexaryutX9citizenship.䀷;iChtianity,[hootemBspeakGA/divzTinrepcoglafsel@PicrlihmJbatic(sKmus)HlX"granxietجHA(txlhY8naujceXŸGsХ0xrkp0'8r~omaYAbs@HquppUologxw(s?ɧݚ8XT۰HXrrel}'!obberyaQ8expXqظix k`APѣyB-l0rЪcurp(dirSo1e컠unf(.oAinflu+taз#rQ. Aeep0Ag*checkstagaPd8Ȣvail wi HHIexerc ˖epruX simcircum8`imdangeȚ`* +, @esu!0pir@opdsPcrequМ@rodu DSuAurH8Ǽ#[pg 064] a/h3DVIIICcabPy FogloomQsLAadn(mpr({sh-w ҲRidbcoAlawnrprocalssuras

FoerResigxx flawor,fiyu@Ҙparזtenable5adopyxe.;p>EvЋ(hendapidly.umouJsomego gobroad,JsgapxliaY. (torytiP aimICleassuBAsיin`m"eueenXhdoubgexop0˗JublicBؑ8aiPdprbitr8a JǦ @ca`hcកY"o-t"yi8extr`mosbɃt0`ب0Xnylik`uateӧfu8duX?peaH()exhswthLowp@frovroyaltaa Ps:sucxs8USHhof͠ Pfi?PO(ay 2n ذemohduzab@yd:˨aMtihrrPa s@I@I@bَa&bӛic)X0lahOcto@ im8iateld;byel?{⿑k¯fulishiZfa1iwA80.I3Iyet(,αGw9:im (), mugXf,HKself ة@. |cho;8llI8rporBsubjalo0ܵk!QdemInisudgmenYereadytwo,ndnlysvitalowersfommfficacyIrel,LActcqague;ylockbat9lifeRdeath;Ncarquestion:whichц(ouldin.romseriousor0o ⇸Arreabillnaalists,42愎peechesade!suppً8ijinmoluntari governʐLviewҌBeXK|cabineelievhXtwhoŽ Јownsc@hav!def0@vama#pay9rH.p>

FoP8o!9ish(crey͚selecYLordeickav ,*husbBfnieMrse'seJostvafri0sadnt8T ci`sP#hoPspablshigh-mid`džžfr؝fnp¢xuXɇ8ewmzpurchase{freshaPinÄ!)cross9jؕЌsee،eh3[pg 067]a/divqMuIs PhnixarkRH1'qr)osBxP3truXParn@XK.ɑ)ȧinetpcu1(@to)why-*tثiXactuPHmpHdj켠㊪PhoxakKaragicokYز@huhStafPdrthc8r1aѯRIfeegayжYȠiwhich_tح rќ1)n!ʋ„mPri Wa H)ٔdign򯕚ZCsympathxP?ҳ2eဈossfnehoasotlyolleague!manyerits,utnear(nnectionndevotedriend.ithorwoc0alousxcepɂthe:fbEnglishresober,ensible,rself-p00epIfa,

0heГHphaЗairra8yMPGladsrsummdXu1noudohsaY)imjihcomure7dosom`usin!himaroomPsolemnibeganhenov*umi8GmaknrenbirludafW1reluntP 19diar Yhelp)Goorcowh訊eedfulY1quȜdRm蛯HQ؛5,0Іz)memor8x markquaeڐBu, Plab(sloweapdHre2xI:+j[pg 069]<c9hɇ}ssI`@0h;Y0IPetPffix⌠ؐ9,et8muPt/ ypX8rx=e"bǞJmjѵEervi`I(, fP Rnthophfutcap(Ȥ:|/٢Woady8A“Ipublicype@̅e(M19)Sex+nreiubjЖ!mupXvm.ou0fi idd:o .8t٧ټ{beIhY0@(Kittx mas)IinkJwarmHchmadHep`n0QRi8I0a+rA(Ju1ǛAk `rt0з@X8rsonhgrieoifHȜYIw0P erown0rrla`$affXoid+X senU;loso uanonTcPiһ݇vahffyK٪`bitps.idh˰0XHɊgo Duw݋hsatñsPcrral;sePڸGA:b)evbeyo i[d.Еpdoubt_2j`osspokyp8Ix㡬whi@s:iʝYgi0upkhi؋@k fel-H9ż(hoIzf(лaQt;KsX!rexЇа*laeM"KXصؼhConnahؾhmaltar;ۆG(Pg#ntanehQ؝u黸irneeI,Aattitu@admirY etrayangua-,4 ;ݵ Dotô0riflagride1rIiW$Ƹ"DehChuriXڗRo1`Flo`H Yzmoړh[pg 070]}a/>ish2fir!M@GsƸni U,r9Ire).alepos=0001334560 id="f_44"44aဈn> Theossf.avendish,Onxdayftqmurders?:receivPahroughsamehannelyhich:Chamberlainadarrixoxxcommunications:Imuthoris肘Parlasta"atfcXiitssaryo`tenance[.'s]osiidyingutviews,ㄷlhould@sigseat,׍8prepardHommedilyoЏg+pl(M7):Kdiv>Myut(oesAerm8aomenty8ertɊl' o(al,uXpvey0youه(Inkedfulgc; dePyXblJIhonouramotxshhbeen!mpted.,@opinIissaidLordranvXeΒg,trinflueaBre;cП1ragZ0agenlarged;bss0➩cavaipdown7Thoscabinet``bqїkknow`,erJvi8Yowsr袀xioUpacifqI074reac’du@w`[ kd Jirlicy`fa{Englh,Bli eHrpasѧCoercAct1882.xoaskn mummexi equitind@ithleaysIJȆxtl:amheجt0yanyrulpؙSpr's.Assu86YseeHQHlpcieq`ᶠsolu.Heɓrytro"knrab9treet2Dubli(DisQQHrq(kҶRoyʏ(nbuyanhm8brokQmetq`ce.ϻYhalĺtRemoisylPerrorcfiاahpax` tr,grпpitchҺwardiw 9t[pg 071]a/>yhaѾygr򅺠jaundHkIlhom2g"gyopab q+JividuCIrivJf1xt.vnQlaw rPshaksirrpoIHdomdei1㷩InkatlegislatI(1881asnfortunateparemistake,oughɁbmyself(membereovernmentonc`ednt. UTmbp:pagebkxml:lang="enЂʀ.h2>Chapt(V.gypt. (-2)Inx77Glads0nAwordswhich evhsanJtrik8ificz.Territorialuesas,id,anobisposȚbHrbitralimits;eanenjoșuxuQaRisoilApincX.exyeAdY(aІhm,nolmhmunitZinhaa,zcircumscri@a ct willourrstn,itlarceporem`onЂH!9almo@0ta eggaΡ0hfrmpirDowJuntaicAlti`t8-scWhNil"wi釲b(;ÆA@aljo0hscros@Hequa02atpCapeowDiɑx1ironiЭP㜰X膀Xs'sfbouPZPC2 ca!bef(o1e c`tщћm0ȷwauncdPh3'' IGD3F8HthfQaܻsexPyY`(up!~bp𹌁n.P*Hs70737@-A-EuropeRi8g 8plexshadHȿlike*troub(ԱnewheeHagudeX@isaaqqh tõȨ)ino蜩()za7IcrBwoPЂwhodiffsa#ervfaffchargdopprepögnmseeٵyiɽDwdYSloixarofligКbCheavHbStskilfuadju8d#rllausɢfX(valu*lr.nluc둝)neglecgv/arm(PJanuA1881ZlАbropxrevoltdyBxcAfidelir(,ѭmue8a1 @ ,@milienoughA@{[)betwCI.¿laypPia7nd0ro(rs:gp)xeٻ0b!pffخciuler, 葘2dZpuhm8*s.uraumn ()TsPPma!hneмenerg9;9calerr=g٬Hпqm.nsuborHyg@؟ȕ pop`Ȓc؝HppHmb@0a|٫ArabiPRhE,pru8fePrigin.׫X ̾ XolJpoic8WW+sher(-i8زSulTurke)sawmxe0ZdiplomcHdHȳ(Q)09dDŽnofeuda0kNi˵Ȯ`PbstngQFactivelyponhecene.eaneeow,hatxpertbservers potaw n,8`atwoowQmistooknaturefArabovement.hey Pcednt0nႀlitaryising.tasitruth)ional welB;qanti-Europeaandb@ll,-`bjec@Turk.

[pg 074]In 1879ng rn1sas impoY !gyp(controll8ilimifunonsutrre ablThipMr.ladnrgulatertorfigXnv@ioheaɍcouyestish!trictnspoxicx|.46/a>at()fact,0nkkPSeptembRLordapbu)comXodefinndtFrenchmbassadorLondoOMwouldo0J)oinflueyhyapet1 ;*1Rr 蜕yXprepar؎akxB*(ext:mighteece؛gffRheiriew;esppquBeaHsfie`УR)SuezaPlwaygard WR!ill-advisAhazourans,ti٨`Engp`(er,p> 1cy͛cne "gPrwҔxt frommСXrTra0t Cairo. Gve (N81)isclaim2ylf-aggУ8ޑ@eȤ1FcPHoPuphoXfadӘyipesecH" creespYBosprus.i@ 0P,oncircumkਰߵQuex񍜗rdu+@caaȠarchy7786727677PJustaP OLA> IITpxwri8scribe@effec:JoiNo8followAwordx(t@xe: {Atairg 076]a/>fepambsh.bodyIreexpЇ8anXudeclaKnwaswaypreaswhyHhouldvelau ed.hKtsoeriou0ep 0lic1grou(cڐadopwittbalcu,r&s)gKj,۞Xak0meȅS(HBo`rusHturback3;Ki@mlain1pupp)sdࡑ;#Egypsor 3shapȀЄꅨmaАX*pTunisgepal mischiev hehdegrees ouragȢhipiAnt!ChamcmilitaryZal,pop@t@m r (ԈEuropAPower*unHy.veryle٪disturb hs°Qctty.nIp>IruyevPif0ǜ܃[hpati`os꣈zunЌ\ocfuPysva놔Rsociexbiobacqutrh91 kAe|XexcihM3Ϸrooantago8mamo)hem,hib@qHpbpIʨ1XmpcasigonҸXrluꐘmoj0QClefokطut.ntupz spX]maplieZs.or揸:7sAinaby Aqu(RZb؟nԝ1ѿBalkXpenجfyicCoPpڨ8xffi0te7ridd@1881-2#lawliquid6835050>w elwinkitl8Jyoyz(sPYЉ`isnp·Ywr:aIslid11ae@gDŽNJ{GQttaatrongbjec:,occûymselves.apXrlikeȉmfAbXoSafirmaxZb:0engages?

Ats㦩YmG ettaellrom@markpqsupH8cy`ma.Ǡobاs 9po`A+schoolIPaou)iҤIqnoc8HwoհIp{wၨry(z@px timI0msi$co`ivu…zheavlcau,ircumspCHIknowg?=c, oacxnd"rashnhurry0amade Imi8jQmimYl |bysqʹmuemptori!rt!mh!,r XuѦarmwhifPpt@ŎQs{goCb𾨒hse.®ry*ur b11ZpulhoAYelckill.͌/Qm!ћԖ؂9ow@r+(dߑes`ⷊhabeex Ple=0001335804 id="hf_51">51/a )/div`3h3L_chdecianyts8Cful/flee( Alexrionret>4(8lu yey)* ioiragep @1T0objꮫeɩs]goodffappearaS fiehreu*par*osOnͻ21, 1882,0 ycineHqsarjѫ ougHõA+5/on,2J(ar W(c![forٝ summoрnedyngland !Franceoperatender o-Frenchontrol,ponqditionspecifith@woowers.ftecamedvisablZops,ecoursehoulead Hterms Turkish̅mPly.orddžpvil0acceded.eropos(May 24)yaddresȅ,1`curenna9al(orBsiqdespat of Egypt..@eycinetsistPthatoupasecarAtsti((June 1),deЌ ChambꌐXpeariousXawhiyighYed,ut `exclu Xe,|is*amilithven.Ԇdeclanarr#cahoibetweenʏoon, ܀bӀallRknowo!fo`lypalatsim.ӌeЎh's0hntloyPeavmovLith.

Tnext|fromWEueajf( sriyBismarckesumcadmi yߊ׍;A8oHyHZihs\r`cab,@)welcomqe,؅ ,owhagyHayhX8afHuKexhduplicifolly, XooiXtirstoiml23) @p0uingahcPePI1tètapnoplSulaКattemptdiv8Pda`legramL8p<5cgKErڞsiPn|hەn>[pg 080] 52/a>uߎ`sHAfluc$2purզ 0xorHykdb㇃x92 *avoi.ismtrujud[ AinowpCock;ZAuAȢ0vuyguag2li rt;Freyc lsoؕC Xerm8Yڽ믩1Ƚټh9thr,[pg 081]a/xBombOflex`p [pg 082]qnewtu3E8,XwPlasuickcrib#{i!inxp8)Hȼmȷ022[aid:lW޴ulischg0dut(webAeav0e :#anarch[fli0(oQ. allookrtɯ"Q!co-odPo*civi+H(caP.‘(8!#obt8񃗎sphau@wQrtakpLslb.$X(džſHmH?e Aؼchiѽ`pect8;@:anxreymple*fndp,⚸wage8vap\in`tabسlxQʈR@;tajealѽ@@ewlPس;uss@@soɠusiexcIgetJrerPrgeڼ1878`vf,65o fulitɢp>4Q un1ҟp o`ٶʇѢ|defjcl ΂1΄1عzbeyo0jobjXksaI9xychJstoo̱noadvecid)oA9sѠɼreXJGttavehwhar`drelzrefusd0Ŭcehs u(bespimЭ`cat(hat8Pշs?rʾ`er0oq,i؀@aport(۽righl`tradkgamya0 Jv.uspicrafBism0Тʃsf0gig@)bbxMHGladnϿ (iextweدȾsu 5Oloupmta`PTu0erda켸-.ɡxnZ p鶩touropeoveredithampsfrmmen;ointingohetfultatesmanshipatadushpAustria oosn`and [pg 083]

Tel-El-KebirHerzegovina,rencouragFranceerselfaoccupyunis75expecta nationseserHheiribertyorutureasiallrgently`hort/nowiwnco.ndinfluHfuchdeas seby:workhrivalonalitiehpX`,Chamanmseajori0n0 Freycinet `ern0tu ffi8(Ju29)asevep aegre8h؆coprotISueza.p>Nayfhbombard3flexPBisbdecd pdetXw)wmildc0ЉxqdȋrX|Merean,vcomHfӒxGatoley.ԛ`eral' lhnespgypci hculbroughimor AXB (Sept. 13)Yp8rapidsiPblЅr3y`itinsurr.1l forceSSmyPcwY㋩recep9S?sB'v٫Hdrear` R8apvfrom llXrs@8Msl aV.ܣjtauy)sstruck@vperhapsdeadlb`@좨 roDginn(ulHwCfancEamassaanBlikehpeХYJimpѵȶъ껀adv[i>towhQɃceIxlueelTntparpk@a%r5caha.ٔco-̦zpR1 Xa!cѓph)utj u8ɗen dhomyȸyou9m"difultWQ/divspoȸcloKwMr.ladse:BeliePsoPp rxl he (I Hst)PalюAfri ship*regaSIhmH,tc.Wcexpl!֐li:ؼaiome`[mo(IQa`arptri@is0{Pleiцd`)_aʖtuÈ Q9riRڟY*th,5wroddž ehalxf`ec@qreply"oos0I葙rsainyࢧ [pg 086] a/>ЃpyYH habel.ÍaZvki commith;ҝ2mtXaHsumve3mbp:pagebkxh2fohsize="+1">ChapVI.oliJubile@(1882-(3)<2Plutarch, #Moraliaǁ. 18.m/pppHetrivesikenthletXllifeong,dhen)heomtoofi(hasat hmeetWQdiv4;OBR:ّ0"12802܂811ʘpK1;4r|ӑӀ32;.793swY798:ۜ{ ݛk˖CujLۡ8131;GϏߚlܞr76ӑllkʞ74ovݐLj?indarןPythlviii35ߛk%ThPsaay!םlaan?z,not?reamshadowankX.et+xrE(nlorympartedromod,adiant@ghtinamȡgenial)sF1W799[_W/.//޹E 13 k̇7GN7K0$wGMMwJ;OlBr1OOn>DiPinceeusrefoshould0PdladursBٓhAwittim@lname?h3I pmeditationhulo@mlourhtop@0@abh`xiamalv8lr whichllrough`wT[pg 088]~/>eep`h.dh!evivid0iousreamurb(buHeslyleHtpyÙsedpXڰrP 9 alwْaqasf0too l9strenunaHenٝmelancholphiloso8c `poex`)m3fhpc8`oȉmimejidIDecembؘrk pocjube.ɶ؆ȝlu XXdblQyhfuladuȸKOxSgrqbӧImo`!country{PXfiftyɧsuMpageYHsX BɡFffh!mX(s`)s rol ivain.ȉ[learny؀changuarthorizar8der,PsocithXȜh0xsh:"cognil)ceٝرp`hurchѡ1ث@:ard@ria)QbenefiјP uPrg)avolu.ӸZ1866}Icac9dcracteu0ers;Bulgaricampaig[Mothhtingpisarlyaithniberty,adflamedHmneweelingorheoicefjpeople.suchs9Ktimehen Ѓ!praytoellowsgoxordershmovbyominatYsenscommonlaimsnAterests1mankind. 'Tjntagi world'sPtain'bnotect;lustr(loyinuitypublicrcetilleft:innermos(dealsɃnundimH.

Hfif8yƒLlifwrought/bi#sevil,ethod,xactneshcentron,Kcast-iron.hedharpenPwha@Xknow@g,amsiYmsk)discricag1Zsay.Ȓ)wayslkؔ Pex0et82exp*.ausoft;ehsiblRcreatu,hnaioliticians.etbodylЗynic*)Weltschmerz,-wicen, ium [pg 089]div>ArƓY򗚊,a_jliyww w"ZscLordӗpsbuضjincongXepixngphras1}9ni ruve.qpierno"tmari@">4𵨣0kte Wso'wkY(ssPnetgeryQegsˊ1le͂1"жroughPoPp.ΎQsamad1pxexcep⫒av,鼣]@know`@pDu(Argyndordansdowneadeftim;(srisholicycosecretary,ndEgyptianׁr.right.hegotntoar,beenaffledgislation7 raise!unpopularfaxesr3afJfulragedy!IrelX.etllemhavecompletelyverxe pubixbyoweZGladstounitingzpendsBfruso#Pbitterwast(societ^mPattachPplasseo.nyboXwhXhnbtwoulXiconclud gnment( extremibu Guildhio9thNmb1882@be`possibleece Xfamoust.ϗtoryewspapxfeloud+/)colleagueQdhabilitmselv71judgZwiarapidznowxoȗ]parlia雘upporzwhyir0tookfice.56hopr(ecȜoiPe "4tdespotic anisinc|hcaropwhichEplacsdisclosedon6ol7n7o>9fon8Zexceeq`du)wo՝aiftyears.

readXhxictunoughomDɪsȥ٬"axrsist9,ڞTbrilX0journalhdI,en؄[[pg 091]a/adivtPhPUnbrokenOda)Hju1e (Dec. 13)кxcelebP@arc`tr1ceiHg2em G[ld;iӼx hr`liberxociZصh9myfudsȱRouЈ9rouɱHs01ifÙ3causܿpf3eHcipz.ƿAȇ newQy(ubscrptIGreek0lsoalcasket.nletanks,96899>fYremIP tooPeerpd׼I 1ʾHwYacceiɫ*stpabйdeclQAtFtouc*Ȭ9ny;belmXken2chouËlly[pg 092]6/$u(nyy؛Za芐icxK`)vonkIaveeservednyfheumerouscknowledgmentshicharecei,speciallyromreeks,nompletinglfPurbparliaalife.ourver-estimatemyHedsughta8roumbleanyinflmPButalab0withiX0measju`ceo x|fue,n}happiolialollectionandbeerainPat vYpahasrgecontributwhplendfacultЍ8possess11Powu@rkind.earn@kou@rdulg@xtooxgiftlhonCmXtc.

Wp4imstatu@caskefp“Xter9aX(ewXinڍarenaJpnothlorubliccЌxumo5exaJenrage•x oqng`deav`ї@dog>III <:[pg 094]ˉ`etoothSctant`renewkn,0Danpdebocknowledgpnbinaaaassi #Xafddison mo@moont수delicatJduties!voihPniLit0lsIdeȗ0o@el(mґ;.Ï+wpyenjoymXlodonҗwho8xm;2wef`parisPwi`thohioseqarmQervoirX3it;vpax,,hy,ul@&Ѓ.Ȕe8xs pssedre0pweet!exaڙmzҕ`ondil`ma@/p/divp>saeekĝPusdia١[pa rgiouЇIPEngdrthirXcuretn͢Glad818qoXHa6fndshipub unbroken,!yqdqmipxs@Hl,%ten#maximprix,IQP,fariI2,$nʓBeaBdogmcl@ishhb`.<ope,qroPhi(Sept. 20, 1882),ttXfunera o-x(x.xصwmhnfulfiCuDehW`sor,;hfirsHos0a(0gpriphockIoobsequѼҜ8pk0AXcʼQyifPB˄XWeslowx(exٹe@heavyXalсrirreJlosae$˪E`ays.C 1}(lxi0yplXccHiasீoint1qmadehcHa]տArchbPopC0erbXѺbeginnDXmbeT1`minYȢ gѱ@sliaS -q@teer궠Ta`ڭeemjc󇾲_easlSt,sb1lipwha[pg 095]Ma/laRehdo7y8so §)9x@Hship,unquР pas.Ǖapucؖice"G`be&ynomv<70DbPgop؎RHaro(Brown边Sc88jdxjanxQkReacchuȮAeustr 5sase)inͱmightiga" wifld notoheork.ȀHasoweventy-oneearsld,ndr.ladstjudged(isoe0odvancangeorBmetropolitthrhimselfeethough0snsefumourtlwayPfprotectivein@feltnecessity9somexplanatoryeason{witmseekleaRf >9Bishop9Winchester:

...taymtranthat,honHwnerȅ`hibitonspicuouslybanoma`ai0raHjunbetweenԎduties, uld:huswardinpretingcircumsPXrheracertainmoritig8Zman!spye@ifferfrom}R1vlo@,wn }Engl, ȇlic`Brprimacȕhobڑow@bld)0eٔOm0attitudaQichqyx)requirAmomPrial*قsuhin, sighock НHa@Hth;BIHn!⠁tiArchkheldᠱhasT˥xma`fXsЌaChuhDeӥtaul'r(RsaiQeclinaugustCerhYocpјZ r.|For@,e}ٽ0 ۾n4cb@ldz=HBoˈ繻 heaİ$, siyPinkyag,cep tʟffice.m/-725/*2.2/H1p>Wh0ѿhrumMhNnd!:omHdģBennª[Truror>ricȷ8lcsupy񾪗zP72ar*oБ!JHbнRaikes'slitthCambridgeConla`weekKaoly9ac8Zrqޙ-Dknow'replidoū"jɋj^argWfav? Ya(mrlf-@k ӻ:ȗ$ruWPerhapswo`)w`wpullx0bomew!over-heniouбhtianio8Z.żiberalh(ook&pview,ilsks vA,[pg 097]n/ٯangPilпʆ$ElizabsettlL\AcUniب ݃(ln0vivȻ蛀yeaaghڄ4mari@progRe+4Íi-ritualhunt wasp.ivilourtsereusyithhensciencendyductflergy.armlessttumaciousriesunderockjkeIteemed ifo mightollow9m,rls02shITgreatractarianatastrop(tfortpinomeewXapeecur.oQommeParchbipptimlikeldohu`mbo09resp0ibility.

WsucAounind,owevxwxayudg`istltogeHrXrhsingȈ`eekxec`siicalon!intutioo0mmosacrbeldallmsahHssocia),͊PGladstonb1havayy8ttlehpersona`bipiral@quitr0d hstatemporhlabHnexp8n`ndQas1byolucord.eC,o:xufreelyulrȏiXr,ys, OfImcertaipnhPyearssx퓁hdi`p@eeak1o(acyzin蠁ub tѝ)`*A)e,parom iylrpo9iYXicase.63/a AqvacancQ0lhZx`_Rd9pW0Œ[pg 098]&/>hI1Xupr1881SStanley8ep頻Jo1eaafoqdxujuo`mPl@tu{ZIop0Hrmo pprovalofferȫjbspea:"Pgeosrtifty )Paˢ0on.5hbe,fQaidAm(!zdi8ڡd2ey,w!xloremembȵȴȭEcPIdeepwȸ8ћCrecen turnG$F(awsYgwLiHXѺУ h8l٪tQC (Feb. 4,)riswi𼯼tviewunbTurkCelpbojipc!aol8iep~`ٱ8ac¾ u ;Xtrix0larg,s otowar`hgоxharb:ought.oGBwr)1876a8ghw`ytwI%QMulay:m\z+*`ys2i9isans;dJ`ri1poeXus]vehi@s(HmҁaHraexH@vividxstgth;`%v(s +Yexssm(nK;轐c9com0hens qui,0rZbalaлXjudgs803855>erhaptɭoޖ////hPoubhnHwqinflueJbnnehe)gқptQlialis(reignnngdwoЮ,em)advagsapȵ4&[pg 099]a/ȹRexuc IVAxcptruofrminiydmeecessabpownbandonXtexchequer.Ɔonita׆Lordartingtmchancellor,eav oomDerpndiafice,u#notet!dyAj(.0viͅChilder oakeplace ,Glads`ePldm (Dec. 1, 1882): ;Tbasaf@Ssou@aԏbelievfrPlabouaxnxietgivcounYasbetPinT@yself,whospyesillalwaysangYfreelndigilantxovr lgtstablishs,pucerv肚lawonawithۏ$rppBimpr ٖgoo@usiry.>p>9cla@SirarlDilaМ8dcabin8rrstibli4snecretaܠ@eig늡<Ȕ؜ᖈdoors;jdmissadicPmusQcXQgآjudgedsucceed;inducך%)y PfailmlobeQ.f ʮnonav ua@ssompa 0sɧpex8e toi0h0nnLJ®ؕXiDk`5sug`nsRnmonarxevHinA-tax. XHsn psliPQri annf豩QueexmopyOaudfy@1din1.Of0t 12.45WȎ fogMaj3P&I, bea0ȴz b*mighb1exp pustubborH٣ۨelca A`nd;lgQwio𤹚ɽpegac moda۴8oo(?ddlo gn1oard r< 18!ceѪhu due|ousǽ7anPderyth.ȷ@rһp*lxa`ur"viewI@ 4ppea9Hsen0xesypSicor0dœJpri@minXdrewa*8)fwh1abm!cluth . Вsr@9HBrcFȹ+cqna8remBaddfύQAdrawLr`pa!۩!yopiȫل򛚡Qixx`hzYWx mad:requisiAhdH>r_E␝нoughRyeؤBȶgallifyihuQYh@pig o(youldearorecceptableoerajestyhan(osefr.right,hixhisiewseHnotnowoanydemocraticnrinciple.Ȅ8urtexpressedfirmpinion (Dec. 22) [pg 101]

Reconstructtughorderb Hqusypeac!dPsom(hadesearH$yЇmemberʁcabineHyetnevgothingiklength?hsuchatt.ncsaidGladstone,ǃmust)deemaHttlacif`Xit s itfor.ԑAleaR yolatoryefle.Cp>Msialparym@`Bpo8iciwhinks0mself1avouritiQstars,җaur@9aoxeHbe +tihc .ϊɈډYhara rimportun⚘kind.< pos=0001338249 id="@xf_67"|67fa>ВHoncollis*opl9friendXQlwayerriimgifhfleepsertIsisagreetalkAhWrGranvil(Ja2, 1883),%wheo8 an 0BsPboubutmsaЁssa)tra)Hupwork,elleltic򞌪p6,aodoj yuCmy Ǖousgivi؆jrso0tbifcZoffymd0إ.H'sdSo8Shirt. AXqnext(y:LnrIrd, 3--4-Z: :rom 78,Ȥ9nrlife.τwos erT򗟷pa ravnafdm1ȭupY(larkp!b be ok (k)nglyhp4+wakb٣issIaskoumebLondonuw2dscepBneitqoaveyXdea,sH雸HttaPnoerok̖ ;ɺ8bi`H閨w@enszIg؞Y}nȁ)iy[pg 102]Ma/>ne gIucirrew>flow9ѨЬ.wYdixHrd07exam虈ٯtep-:heav8fuhs.h`icaeaaxacc8npgeI,Yi`pbad1PjexpJMidl[urgcgaЭcX.

TqhieX1(TicQ`WH⽠Ƿ{adub1o+nounQu:0abon)Dr.@indjn$nh,́Glad#":;divInrajyؤa{5ȾrsAmviڌwˁDob8v ]24(April0,70mhaAdA himaspJ.Ⱥrfaily{dsݠ@)a9(%oll)umbsubm𚋋PAadmi*{mu迥 bٚ¿equ'$t guitaZoh˧pXiHkY􄱁߁ݿ;psQAແnړi1( ewNxA5poacO'#isafapexɞqhncenjoy۴or錈A(likelihood1r]B;Youbڿnaner(g؉ةYrarqlawspp(iament,ndoarscottishisestablhmHsoncernedeoesotivehat+quion肘maderogressuringecyears;"may t\inkqarrangeAslyor脸expectvisioidlothian,Yhad((ariousvertuBdepuЅnXxsubj,hichMbeen o ide.

=kh3>V

Onanuary 17lowithrs.ladstonethCrosaidood-by2manpriendsHD iLordNjvilltfollowftouqimselfannegf Wol!eXteau s[pg 103]a/p-Holid0AB,Lnobuddmiryl񀙇dxceed`evbtycomt.܃mHere,y\well鎊SreigpourLsnack ly,jeunp9is,reak-upRen.mu ywonderfulc|vaahIao'2icendiTfifeHeЛps8di throug;#Odyssey,ixon(HiȗChurؒEngXdSch@rMiscaniTLXClerk-MaxwHg@X talk@wRJAc0sersonal,Halrelig2SbrФP>8muni(deePZll-fd"mo`ssfaHh߯xMrwrHlst.tookr0sgardePstru` fairyQ. PpؠWalYA atpalw`P9ᙦCom@P.鵘cPǦDukArgyl09oldrviv89ѷءy(s8ɫkeptppretsucc蛰yt@apee"Hartțabologan3nɒpdrewomەbl׮׽er,釠ekwlsew.ripPsseowRldP(ъ-pdeg ptweeS.t,bwhaXXadosympy

_Z(Jan. 31, 1883)GQuins@ upPQdiaam(BlᣱnexsshpB{aa rag-i8Z,vtr(.BҠPZ(b!l¿t!ˍher፼.XCsGbd (FebH):divHremovin迡H: Iink-pHgxHgXrXl(ҞѸX0sivȠrmyy regB"HBanyشxP1bvʾsٶptepYquin4sreatedyheresentifficulty.ts @llyostindfQueenoestifyuchnntept,hdquosowanswerer.ououldphbet perhapsreasi`th8I.

Pdrememb@casePeneyچLGQommonxaf`lb-evy'ynPsShsistfiitxmfulcPp(xtoHFcHm(jlnt uioEngl.burdepublicf ntogI nݚ @rahr.emad smillu⸠!qnonbbZrodu@m'1Ⱦ Jb`llhiv-hunXq4}MPh 2R`xo0,rap(8sagibowjSt@tPShortlp,eXreAKhhGlad)paahPHa[HWaذ'v\{30, 1883GBA11"oӿ9ham.ҥixi(oStoPpiaworѻ LondXmunB諾31aHﺨ.oot-c!kȧЦл)!noon;Heasaks%8k; fɝifHzit@splp@woe-Зx'dAbi(%oQL)Hlew[Law@achygApril 1߷ڐmhu`,iPNewroodrvi`ڀh s?.Ԗ'bmeHн9s.uO-gپQDukCamxdgANtȹCȓѽ(Re@V轨;Xnhh;WWǶ;'sGChc`m)tc.i[pg 106]a/Ğ#. 3.15|QuQύ/in_H9to8woyxҤGadyʰx8husbмdx禇0߿T reluctUuuphyourрorrowtillhresh,ndhileegfounoccountYknowledgehiste,canXefrainomritingssure9only!myympathyithrrief,uH"profdensetheosschz"ryZitsudiciahaveustedydeLringuishhusb.ƆAitimʇfirstpancenparliamfollowAlegalxposxonQangnotRferviddmiraAldhelplachim:sXk8BY:few,umanbaprfulawyerAduralfXcuI nJhear nt.henB@H92asYeaguZ[reaseIlesiresuperioPo(nsides9pecun:@st,trotenouoffic`thoroughPXoluy(charac.he苠ords,Byfee,ealXaenu,riJaemoSIPplch .arn anxthatjma\eve@YolZYҎvve

April 19>j(hAuforkiHamZgiv`ҍ0iBo󏰠Bh郹4wealtIopurtr HliviwdBzXxlikou endencies.@myselhaptzit XaxuJ?Bbe@mitthɘ@oH@pPs i bilettacllif(ʳʍNjQ.lefXitX,88Ja compeJescapsoŶrHiɶhdecli霨aggaSir..arXrv27wrAax֟ Ә#1 lexX0la`night;ato [[pg 107]Ea/$}zѿ qpH|ofp(agesixJslength>@ileX=0001339( id="ref_69"469a}Y`pinicts fg>༰m8!Рorl>8gladnHlfndjPlAJha+a8tt(waryjudi faculHyɡhsisbsY* 8g9acg?=/divrApplic3w`madٙ"AйopʐrAxHon|پhrepl@L!dd pXe]zeiȷb/,lZՇ de8r srycaIyBbhذhng , m vkntɲ@3b5rdPcŵ offxneоItiwh( bestowXmBi2ɴusfryP"wia!EPPīn>Ju4, 1883_Zbprob@Dduxhfifp C cYy@@fϸcX¸p@0odelsCxn11xcephoos8ȌitoohrmfHr@fide1ro-o"иeedlfalapH ex єP2aԓcafmeejclaiadIAqF=lef.orlh]PY$fir[،usu 0lፒs1W̼Reȓ,pqk,xr"g ȐXhijA{PoweA3pre!(w٧Wlegl,рnlyevenaveePactualgi,feckonightly.doothink0aZstatef@sanueoebsencRcasesntitled consideratioandamuicertainisSocount@foryarommterm@partyot8stasbvious9mhI <:[pg 108]˃ldcre1aed؈deviromPrsenngxpu8mprcessorf ȅies,ithout@sfyselfaew9mproceed)wJh8sonabl safe.ԌexaminkivcircumЄsuch IAcjrexresiown udifficulinvid:↘/*pe)Y-oIialrpsfuncbڌ,`,idischarganzaryb/esp鉚 exemp uspon.Ӊpl0mayccur.ilepos=0001339186 id="eref_70"70M/a p8pTo.R.H.PriWaln>August 14thv mshockHmisswhixIxdea0nqAfailaskoyHn'se3firPxordlXpagxҞB8PratteqyH8RCʠnearday"diwho`QanymAundJamb@1+fhHwРȔ@(ilElperqgehdp ed;Iج8olle !pplic6saruuArchbip (Howley)arbur«8hHsЊ|ch׉֜ZiyorhispeeDrarpֱ`me@ȉAcrPѪXأc8bkpeopx0xirf6lawPadist`;seeyxhibeSprjnexmasr yaHhgracefucIgn q(ifQϚ΁ي=p:8guilobHu G/divEv(pic 7eUnA𻌫@{olemqMr8ladstonn,񛁭sciou2iYïhuHSRXc@9a0׼ 10/t="4em"D

<3mbp:pagebreak/>

ChapterII.olleaguesNorthernruiseEgypt. (1883)Sparksfishall0own (ittheed(ivesi richojheavyils(h3xIߋ3T8sessip1asbynHegislaterformanceAfirst@der,bvdgaincorruptracticXatlehons.ԉYinvaluabmeasurezythroughHousComminlySirenryamesattorney eral,hoskianemausin@0deeڄi ieve+suppogpmselonxstʌ)ubjX,xcitMr.ladst'sdiaPdmirXon;霐trengnpeculiar`warmegardwhQheld7,nbuvey(j aypoicPsyBc8 riminisqadu,XaalwX,u(chypt8secondadHsc(negxw0腰mpq,ad, (&НcarebadAaonmpNp St*.@psqspsoHoʘ cabȐ@ accepgmo2pledgQ(qYomy (Al 3). @abayCongotak(Ragne੨upzPaty-mak owcrownjᘐoآ(emec)e8natlcТȌ#t zeal( wrepresn)Ѣh9cc1btrom69 c[pg 111]EaH="-xqBrightXIrishxiondHloyalإAdoզy xhe)ascrapimprupee1ivi\XourPغP1ښ9p)unfail.ft4diffi؎ )1Queen,tׯL852Bpmb0irgham#iicbC (Ju(13)Mtw0y-fifInnrsپWnn ithr.t 8tr0anguab9[rebels,thPB਑: 35ww'!+/j)apx^brЎssoci{enem|rpWPӏBJӇ,f owq@Mise:(a)Ód; (b)a! Ќallowednebate?upposeououldgreeithehat(eyannoteroved;nddoubthe0r[KP.heuestion arreachf8ivilegesoouse;upeakhavoay,fllupon,eiablMympress <:[pg 112]˅B؊#othinkЉishYplseexՂcrext ^IComm./p/divp>=hasjottingIhdiarhimesa 8man's c:;1June 186Excijsi.rightHlanguaaboxIrrebx.ertainly^wvexstroquitadmifpoke@sInn(sa#QNorthco@ec9akiiczƅsid!,xoughdeny>Eiqtit,툹garwordxH LjnoturgHbfriMr@hamberl`a8avi`businH,RQmucor舨Idifficult"pla.HXAygeneralnciplewilob8u!e@re;ToirenP8onbyϘɁ]22.Re?qyspeechmhhaŀHHntilqwarncr0ttإ1GranIHamiltaqm(doetsola@smypnewp(ѨnJimust)deepAret.׋p0dobЫk){elebrarop Ұ1כd uHrtookDo {,8caAhyear9parliamenthowpoyac`)al٫|hjpolemix,JeankruptcyH뒋opxpfro point f `wsUfir8rel#e*cab`rmo(hecixǁro4;di@@BciPY9holdaxtߝ. 26IPpr`g\'fXbɦcJbe`aatuopAunitPoffern怡0colhimselfsɽ0engثp:`Sd nexҶȽI1CoblubddPs`my_[pg 113]a/lre0bʔSǚí*re8qioc H.A,ke,y[c@aཐXjudgiLeH aexaggteHbattituassumR8:ivc߼ Lソx1, 1883{cYG!lanB[b]BAm(swrost fos?Pmiq*cm0maؒ)eembcpm@li@li(p%NI؅P0pobXxx[ircumi U2Hfвh3ti(dؘ:gYaurp,zqhon*gonrequiYM߹a(gyɹWexerci9@)lXucȧ˿rm mod ervPW Birm@ݸediargeiguitwha@bsخoٺfpviduXahQ aodyZGbraxxaf8i`!scsxe`{nPs9R໱moa,рfheodenhichibertyspeeisoeeconcileditYmitationYacQ. ThingYmu(ysetwZЧe),p`Cѩ)rivatx{ancleman.֜sta`rd8rom,nclShaw,hح(Qea,xx maworkmsibpsqngallowؐ7edorirem`xS)Ismh.ԻpZtigh(q([iq).«ɽe\89acani"Gel'sahZHorigidh`ȘP officѴxquasi-bhwdecRm re sW-A7m+@ȷ u0cpeec8rcabBӨPembeX\ImtnjoccurrSX,uGBwr,uY b̛iyupǀoa8aaiproc8ah"snyan8:excepcQueeHadIli=dYp/b!Beselu(ylabouq[pg 115]a/̹OD^ <:PHrokM, 4000nsX10eet)wa,eh؊@smQdegreedep)njweaPencouragHhisllow-voyrandvenmself,oughmostiffetailoh(qview\vesP pnowNorSeaunno؊ChristiansaXwaxfromhPPropos8gjCohn,owgatouchBrshi;middlen8@ek.r.ladsPeumblPrusts,circumstaȎo may((cu@.u/pxpqTennyswhoYəparqpPseem؍@njoyȇMflo((c Ps1 mwiseniapp{Trege1 SbeHvariab aavyoAtlantic ؇oin`nxsheled;❄rmybhoxbehav`emewHhardَXwol0il蟸*zfogύɟz[pg 116] a/5i>S(灧S热Mou諄ThhSept. 20, 1883Pϥn>᫪I*eurepyhfretutAɝתLondonpasssrapidfavْXhahonwifh@daȯocس2ۧ*receivvio дtƔ8borxn͆(ayfo@ippȠ٢illr X `pY[g* @mi(:fami0ldsewp!1sxulard@chaZjm lZaHcɴ``acPhiAaYvad,H mprupسxzs epma!js8{xkX(QP@sc0oulȮ@x(lii`Xǯe(tSixuticѭؾuntrIunba(=lild`, etynaYFliaʶtr#sroof__g8yCisPH*ַoEmRu@aOealt8b8rrangpwty' inʲ@rViviax׃׻KqQuApDen߆U!WUHJr'dbo뉒;rcknowledgtoЙo d@ wisځHpeechʟYn@afrifeelGHtraow"Tssf ڣkishoaog unitQhem3iibnSc inayIn(Permovigor aAE0sadrawn`pfluno2تeriZcrowtogeʭءHmchck98Tennyѻw;poempsrȧlrHc1࿰` doorBetw123Ǹf ProCl,miRntQ wQboX'סyach@3am*Elorepg 117a/>ϲɶimu(abs0)j//o)ire*

<Sept. 22, 1883Mr.ladstone qents:humbleutyQyourajestybocknowledge/('setter20th ۅ xgivingHmullreditorotreflect(attime߈>whe ecidedsφeliPexteArecȄhuishoorway DeniHeykytat`hhadhsire ayoala,fhaew`t0litt8$fi8peculiarȒf.uXalso`ssiq9acquiedaoȖ(rigindith iTennyson)spaQtoha,(e*p0ReomssociatP(erain;WQc annexinvipQdх:k!Z(rmiHf;GmoQexashga׏Hcommunicimaisillustr paQO!Pembrokeasp7 sxldrrangeǞoughtba1]a@hs.׎ɛ(nPucp a(aa׉ ,rp Hnunp0habitumXmporta@P meetaHpmx8lRhe8dMpla*8nt!unHmIrPt~soX@Fborg倐p,Qsuڳ(Bmischȱ9ygn. вppow,ӌ)olgEnlehaiHpa@bᷪtwexdjȋXPne0#quP(hf w)an`XPnyRXguilPllyǪGn>Thadopyre2viewwcJrm[ʵA(>exџ~e0HdɳbXKٷ|Hells󶀯tBulgaria)AwXѷh؉ Huxs؃0republicffairs./div2IXtrkwPalpoehor [pg 118]a/>zfow-guHɠlfantH8ifغSjPXeom0plط1poic!dȽqiffbetwòsmhoA.,onlifclab,ai`cor#Rpo(iRar`;wn;:s`rksigYfiPI`xpdureȉyԊ s 8my,yxP[wȨk#w)CwHdisy(;PLauiDriۈ ÔrɄ ndie.h3III

Egypnffairs 膱1heavtoa 8[pg 119]div>Occupf mɐX۪odutrolq9F`raislmoimmate@afٯbn,pHXsuppor`0mulk1ref0o!tamyco-Sҭworwelligi0lhbBaBnihٵeHntbetrayXinweaky.upu𱐲@(diplomcstyl libertyacB";[hTpa2negoHjӌxaSwhiBrZegagehy0,Ѕɚ͍wrpo91bptoe?ecauiH_behaпt ahHpobp˺gooaQؤ.`Buuqi|abl@Irough aPPL8os` k,ڋ`|ȿIpvQfe8s魐mpensj.hssl0wxڷdrawal,߲beiAuQ4PpYFal.Υ em( žeexb𪀯fava,܆.parrod[pg 120]-a/>Xj@0eniyGilagHWfolem p=AdppUlipڌ?3whhHxhal,H Com(l di؛t9۩ew,bodydoub,ȫiy˯Kdeh•cьtA8߬g9r)coHid!RsȶgpucðA poppr,;726a>yte@chнhhh8Yex(sL:coB`fielў`w(xbг৉HxtrqdifficulдE4X/Ampli Rꨕowdvp෨Ne$߳afQTel-KebirainpBhqurȾۨHA"Ibp.ӨP(l,ilitarHccutak hmH)mp))yY UenaYjviݿhgierzR{ obey.`ܡPuQ*fiam ۍxҾѽoe`Toverngyptromondonhroughativeinistry,asnactothingutnnexhon,`dnyitslumsiesadoHt8blesomehape.ucpolicyrleaoflloeeconciledithevoẃxdrawal.o`easters xmereiphpuppetsKoopexm ex:authoritypgov!coun yselve(pudelus.

Soyforurlsin@ny8acapEur Јrgucinaalituindescriba0mplex. I timesear,cdiv>ianƆeFuezan!hinAg@}_]=󿨧IumxRtRisliXȢ|alI5VinfluqXtrow虀becauةPsx"Iq8bad0garomplQʽtpfoȰonyлlosؽ 2.iirmQn d8sdhisxt;deaٺ!l۵;ntrp8zifacHCqr2ɼ 0ѧ(Ag0sM^.declؼ!Jylj 9ʿeispirisaiHxH4unitiطup>In͖Ph5fegocth8ŰHlYLonHonv8sig)ridۻspxolveTYmadcAyeabfic9re8wp,yP*e@bشowview=Ȓv٦RT8 welfarefgyptndheitterxnoyancFrRaturositionncountry,EnglishovernmentPucceededinducingllpartiesXrn0togreeIsoeasonabl8nrge.73

Meanwh ,sehsoonquesproperit@ned,adroughtp'$Souda!withA0incid 2madeMr.ladstoneD lack0ay0(Phnixark.ChapYVIII". (y)saidǭ£club!y(Ӧmisar@!,%)8p¨l90Pdiff*پyexcexhasir(EqurڬwurgSodde(im0ryabs0sвfuXict eYX(HpCommon+PɯlduppIn* cPwayqmat7HpokIrZlݵ2daily-gr nespwIdescriȣҡKRnggbquncr(zTbeyoJrXn`ihe(໑esplset˃#ܼiiwtwasknePZj[m̿abxre隗ex蟐spiDfaRixani@9in䡹ϼShbeen#0s7J(saشxsyxIobsHa9upYabanٿd erشZПJ܂әsbec Jrlav*dpٽ[pg 124]a/>$0igniahembX_F@y`e@provpOl񜡧zZtl<:aʋiripjuBapplzeZd`Љbod8,vy8isobjsecfr8Plpʿiwef@tta⺈Co@higdea~graduloiParn!f8Ւ$?;Adoo1cʫ8࿰R;w+ eo`epIn's Ȥ(1833) 395U (Bpeakpluded)onupeecȺs 5765.ifVla,ȿ3ₗirx21,160AȭJp toimenhisarliamentyr.ladstoneerearious,ndtheccasionfanyierce*stubbornonflicts.utsubject Єeighestegreechnicalonly`telligiblhoshossaid, passyirivesiwalls IIT*epoAhPDcoufra`1867adeءerr okoughfirp8s)Po œ4Telyan.Ƀ76 ProdutwonS6 c#[pg 125]a/X-CQyƉ-p>ar8gp8seat8maduax r𭄟{woЬaoixfrnoGA@ur|a8Wma1nrkrann},ur aboit,t watriumpط71880Pll`opiP)dop59grn0posaincipsuchI/+76.ϻܯabuxback+himself,xa9skiePf(םhrstruck;f0ѿbi(med.Τ,ʼgñasHarøxp$umbɵi0innºP3̆HraXa"p)om ֗Т`Դ2xκЪ=nsix;XniavoAxJqЧjBtty)friS(ikew^geYVQwhiHiPiЬܠ`mitted莓aervsit̯compmagnituDop!thusc (Feb. 28,4): 32ѹpaS9-̈́xaýtaABish 8t;gggpaccRi@atjLohnu`ll, 500,0 hGAllbribesIDanorWal(etPelham,74/a p>

O8rdadyop@PdisappearfromznYr.ladst0'sqmXti8plac8jnal)i hadcarananimerdicRojL؎Qmajo,r1f 59ꚠj50yuQamildly@ll@Unffectual`a( ,PorXpriiy8jٖTPissu8if(I؟(P!.׉tPe8with`recsince{f`آ(d 4elmjtakc6newPHbɈ؍8l)dvparliamHary atAt ulklmtfnaa(Ʉ$UntJВnawbefoxqDisraeliduca1a.!a rea0HlouЂh+norkPˢ+nedPtwh9(l(a@tEixybP᱈unkllot*sRdd.ap1fli11sp+ruinpPunfavabPi0Թexmin i t@qjockeE[pg 127]&/tdiv\BaRB(By "Qp@s1onloo huxcbnoffic y`uڇbp:xDuk"Argy pi:,f8|bchPhpؼ1Saim\shثbedlahTI`ju w-judicii`hnk-day.p>AArYsh8sporY:platpmKigo(pg1markutumncH.ɽdouၦbegcampabehalP*@ral seherexЛ again(Ad08legis(a-dvantagI@1Hsf񸨳,ȡ0l0,mebody)a9g;inȆ Уfhnck`xividua0Xɒ9muni(Zhself-{ta gesnachronismhatakesXeasiestfllrksorockerydttack,oongstasts.obody@doubtifr.ladstoneadeenfranticemagogue fretfulevolutith@opp@nts [pg 128]ought, nowexcellhancpfring2qu 9Hous2Lordhrreshiblyoont.Zwas,miMrmaiseyJlieutendurter`overcountryjoderat(ce,laboeappeal,aid,r`hȌbeaА/(.

Orepropassanspeechjautumcquiupeculiarignifip8liev":wer.comqyr follow.ȗ*dithargumQeditatecbpagainxflee2opinPs:div>Hregardsolidrma]%?טv twelXparhiYRemct,I┠sayʀs9蒀y m,ah@exhibit$neHTЙoцab)joritylh ȥam 1841@7.Ɂ[ca;uB6pxonservgnpSiroteeli[tiidisҊעohnussȈA5.…򘡭yfר;youJI먹a`od [Beafield's?t],wHalkXl:ubjX1Imej,hiHyyHtim ʎ 옟kIdmiBben"end[Io,okab8ai mo0zfiftyesIΟviJǟ ou:4n𽘙sb׉>organiz stXNx0u74ilX"aґ|iside;STFRQ.r׼ҸsympyGl!siz_¾мyeol`w(@wXty-f)lpraPcy_𾘰ifesҷ dencibuA6oonяhoroughlyIYauu@, zadequ explainef8C:xs0hij67y84`sul4мsaplaw[rulour ʑ1th²poMGladstyjusketX`sВAѿ$lfzpXynһ-dixopuȧppȍh3III

Thisxcum(emed,nrhetoricallmostissite,as"start-poiXXceedpaafterh`ouifficultiesadeenuntey enceraorkZhrough 1powparliaauth`tyc9rXphfipaciȑona󄐄olitiettle.t*Mr.Ǐstx'stesmanship3bJY7nHsiY!reachp8[pg 130]a/ euqdeep@struckoxHAP1yrgȗ9xne ٗy ;sed.hdoube8ban oPdesi @chang–؋*șAH2Lords,il`dishutX`y؝tsgrav9 ub (Aug. 31).ӕePiclinakomepsscertainxPeadpݙaiewinducmimo@ir1mme)eu8Rmo viBir(Sep 13), Yn_YhimselaedhɦCdcromisѨ(on9a`Wap1bth!T0Qugg؉2aasolu#aHu)saf nti(esaf :ӧ9NIh8SvRrPem'(ComsruplFYePXf avyyJPwJ:Gnorganic鴪z gj觫8eȒ pneJBtwup@ٰṙo!ubllifsh iI8fer;KoHsurqool+amR!fussG!voiWepweeke8e A(3ef.`(_too@erhaali dɁrcpep; axg b`8Cd%0A@IѼXIbrmyZ/3adoplanPh 1832/Wpeoptalk3q7x@C}cҥRr`iscorn:]Ahrvellqc@!ρPuңPappvȵuciЊ;zp§zm 򟈂_ma8PýP貭lapo@oploy)bɼ;8axPYrtuy`se!w}KWyxythrough.孛p>IX`9sHchC[pg1]5a/W

Meanwhile0ha0workAorTs.ȁKurgY(Oct. 2)"Gvilmaeef(orٌ(ee1infoH!av{bh`p@r8qautumn himself garnea(avest{ 2, 1884KIehfelpugnXhcrupabouddґHyourAny;asubjaature,fw finɍ4inlimitsu(Bhseempmhsib(xrefu(dȑDaccounthxassH HIӣ,r;[pg 132]a/Ρ"coadjude yaxiptreng( influª;urإBthrow٫aF:H§s;,!f earliȩ:p,Hom=tatep`cehmabab௔Jdifficut lefҳ8rswAdlPh9jstituQroarЮPYu@ii1832./Toennys (spirиpo8xaiFo wlgte,q,؇(e (R6) ճшixIanhelpan(Ih @eP<3pPb@hhJ0uggpȼsudac(byoAzIYsober-9erv !gts1:pЬp/ ;ra-radтPlhePʎdst)gle٣Ye!HvegoodYd|battoIbegu8e`humili8ɩIrtX0g }(my딈ledge)arʷϻlean0̵ث,(`v!goXnm80ibConly'trsaanaԸ poetmap@enBexquȨ`gifPbeautppsu1hX -РduPAe拨f𹸭 H-hor tHencies.)t8f)@1rosZ[pg 133]Ma/zfhize="-1">NegotAuasor.hamberlx,hoas hislement,ponefnt(!Gladstwrote (Oct. 8):

ؑiledᛰpp)ʖYbeZ᥉takZrh(.heyH؟ welvQ\*doarrgrlef8puЏepbahi d.ަ

Thrsr11(iprXnisiRmarkfurPge?=AldBZ˰@*peeches[madʋsk!cilÎh`nY@8ffic ,es`1ȶ9wit`oissuH\Ib螁avP(iobt9 Юop8zuadsЦxego pLbas7n@kHanley@GaagڒsuggШʿߪ Iammunic#j^trusr' tgri(mornpS[pg 134]a/yew0ooitPfagt}acknowledg,0fZksx0Majy身xl-tdftPxabo od.H-,wHocedeelangu kid,y8gonhtyp>Happilmighb[body(membac:d@ȁsRem li1832rasaa a <Xpȹzh2{xBѨ+autumprud񆳢becauneaskneq0sub`Zlug곉`al0jp>9 `vibe81eroE[+uиg[@b`yon`dwȩQo9pJuɚ,I s2esisثciäH0tȨiɑ@@uhJalm%q$XXal9ȸ(<ile=0001088 id="ref_77"t77aHMeanSMicha@HicBeahlxк!@rovr*YaLsida nȼview:ojHwarm8enrag+@nϻs򼘢HuliarfitbaskNenjoyfuonf@A߀ai.H;yzۗ#ڮswoltookJextqy  franchiseorpted,ndheironferencesurnedrettyxclusivelynedistribution.ӁMichaelssЂepara!frbanromuralreas whatasorpecificalimporthdvocacXfingle-member one-hor0xstituies.ȁownongperiaacattdgriculdivishadvid0msuchCithouseholdfgeouxbenworkable.ordarttknewtwoՆoi [pg 135]

<>TQueen'suggeonI8ty,(cayyadxpen(Xig㒰idatdrad.ut ot8ku{qlifreath6ouXt8oughwellprd$Salisburto8na#hebmmun0pb(+knbycolleaguce1ُ՗i{sa StafdΗxhcounervedacceptoarabine0f veAviewsavourSoppntolectorweepY+9nmբypbas8thuhmJl0ightoceYordlqers`iHd. ӆy rXirpoh.h3+IVwsXiOlastaOhrɔXMr.ladsBalal:7KQnkᩀiaeaЦirr9omɈ1dAi䕕ɑ0boHHIs0`CsonuH8Argypanpcnд!ʖgonm)si:˪hemployQr(boYeɶasY!solv)8ڋOYj89m0ol³p_[!Pȓ–Ջj,h)ct(defplѳvֽbeliБ,w ig(xW;bhnimS;lA@Tur obtahfeelЉhutimpr;sxrirx٘, Hnunusual,9AQhowu/ecogni[؟PȬ1pa Bl`qlict"+ eas0`Acommsʪdo sl8IIqy rhaPhonabl `H"owQa\ca@icea(qЗrulraitX{hi cheerply&R'sп rdpoaí,=atta车+w9iPtr ȪئIliteouy ш(Nov. 5)Xacqutw$!ɚautumnbeganeƬ؞ ك(roducag re`ays(⫂quyun frocampdeb!1Ih dحyilHor p غ@e-elhgceHng*Qكenac cloudDisc(nMviewopiup.ץхjhi+11)ȱԭPXLq t@paӯszdeclamipenemy.KelXrpXfic.ɟ0bgeeacJi1j1rI d  peace.hearleysfordartingtonndirichaelickshameo nd.

Mr.ladse,ate Pightofterhis (Nov. 14),adongonversati with*Staff Northcoat8eous0ffriqȀauthorityycabinet (notiven specialn view)!promiiroducꃢSeatsilleCcommitteetagaFranceins,Avided wasssurxthPituld(䊙outanger @retardife./madeoodAgres`pciplePistribuɑn; awkwyfSalisbury;~t)lpthrough,ntiyey@[ACons.oePiseagapbrokoff)only@pHow⋢auffictumbșE'Hdhn8wleavim lurcHif[pg 137]+div>ConfAcW eٷ0􅤶Xpolx3ʨm$4@Dұwqذ ճhri1curi) (Ql@kepA`rpymA cce*?redevoP ctrad')Vhimsel (ser`ipiTQTsa@sXv` quhzHp

Iishgiveou assuranca؆privaȃ0muntionshiI1goingliberalnciplesweld0aterm m,zpnoangeThosexthom!ferthinkс outoubt)partyЂests؋ffectedyщrSargem,8xaistXtatX(Imtgood somers;uenoposi!I(st(d Ipȁnz:aide.polp02@essial@deHslipHy9nysircumHbeu`fied;pvPeculiapaȇe8onhwX{l(.On em 27 ™r;"b0inue CpnXl_ZtwwoetleadhP)8br램app(in.Hfirsuty,F`sai 4Aten8 gefuhank(rajpyQ8e,qciou)txfluɞ'shotri8PbHgxacYodJ{IPrarisfa0.FHe[pg 139]a/ȧ_Jfpize="-1">@SettcP0kgduLalisbu!SirtNhhcohEmanxyPdu(diffip`mpt൨l:IHreturttele8ms (𙌟8(uaؤaopḰB fndAupgocremarkWlrQmhdnxsжrcrdesirPgٴ8Qв(equitysSea biҟ`n9mo0agreerecocۼp highhum2sPQa*be.ӳ)I_ amhed@5i(tospiritlahm htry1,JCҳ`(elfѥPyĻFs@nQ.septicd:8738$9mSfrihy]placexv8sugg`]ҸFamqgiv9ageX!AЭ@G((Dec. 5)οtibgn2Iwhormk'bISyno됬sixe`:per nx/Ib^Vk\h3ϭ+V73P)Ofuepiso8ervPy*,3rbȥȧjbHa}woq]wheexXs2۸pAafranc0brurhse =limi4GtœPar5appb gdom,finH!scubmorn1sittpꤻ8!Ma8NoboБȩpa x1geCspeem(xXIPhcluhPlunket,loXPȉߨʀqɽ(orhomel9!sim qat0arn{ȋpalkmili]oEnnH)guag@iteaa;xٮundtٙ1inhabjbs[pg 140]a/>,HewJȃ/irty-f^xx poȹerܭp(Y/n'takYrxزP:Zne鼘e>easu#streng#Э[B loyibohKPpQnc Yopini videdbligationonfluenceshichnglishmenereollynablereae.h inoftytraxMr.lunketoretoldhat(eeasuiy;askpasXouleadp8,ndprecipitate,esttfseparr`zty.eminahisearersempihbe8rnot톀ynduraЃitsHiQasailonsagac jfirmness#commsens``patriotism,hiliaq;„kwithxferXHayer߇htorieutYmighthavtellunathreeingdoms 8r@a؈qhonour€poacJnevHbrokȋH(ic  igneyielٓ lasthdeispo(icalmbPon{xexig`ih8BrXtes.

Єap'Qdic,`em n,dep蓙convumadofom.etaryndslowgongangwayhyX0o(Xrdefvete0(nxpobptšhchppH.naupn؜0ed.ɤXwouZGlad蜉sw@ktq(.on0AweHaoupbp!W9hjI0Yvoicam@erIg$uplifJr؏ashetuousixwhhmyyXiidyYkҭPt XӪkhannHXiQsow9rouXsuc(si ꊊwixsa0r{b9chapDdisg)zҍyIH؃3sbjuaId)iXflЩゼ,f׆ io€iYw0d8cri9, [pg 141]kdiv>Gt0Speechconfiscationfroperty,uindustrwith)alQcapital,miseretchedness, ar.eenxaicabinetparliament.techordartington'sutyowoovesedeadHvis shicheadescribeds0unwMr.m8ouhimselsobject!brilntckromdarlЎ8belъgangway (hiswnide.

R`olph)ducyrriouthough `ntsosdbe` yolinrgui(h!atham whoivÃud ЅЏhacȐlcmoneysav0s'ankĆaЈ⇊f{takeineHpticHsvie bouЃ4englishgricultur8lYressperIceedЉsFenx`tؔ pWcbaby"inc8sp r Г8ry`ѠHGAifeob`vedunfavablљvoluYay ]qmuchHleg8matIflueRoyico8class.ϢxlIexժncHW0!gc2l .٥ohgala(HX100Pmcr )faatopportun"alor]8 ksomethWxcaПfScoemberct8eypen@r tona𤠚acpredicCvamނpeopĠ г1nonloyalɀlȱЕ1ogprnaplx(d`Hnlyrs@QwXunsafP|*fi*tAPeffĺcAuannihik̶lҀ(8G䟟swamp4-r}ommi8reH0wo-rdihtXA_ҨݐгpCHamil(CXKmXttcloHhlYihec[pg 143]div>A,bfu!)𙖣؎>PequaliHWprȢ8igidrci뉸fc[leaٶ9def2ɤc A@.dBeyo(owdoubt, oee⠄Ro8da Dublтhw!4'𹀺seШ!,@oȾ sre!y@deHc o_ npenerel(whyIQli(řy(څ@Ybxfsel`Hkh(xcaem!Ȣb!hoose܃halgiuincluHaFޚ0)غɃ۱Xuh[9gc. ߚ284ߚ99> cЃ89m' 0[)2xn:a|hty-fӍho useholduffrageereoncededoreland,heyoupcomeackinetytrong.80hatas9nlyiffhP.ore9ough 0naturalXsupportinclusion,ge589gb1f1g>S dispensable1successfisolicy, hwatchproceedingsmittee calmmightav'ahttЃXfro0)mi

""aЬIg`豢arebelswI__^ld*:Jfř?iWdethȵMarc AurelihSou(Fce.pXiQ@tS,w, 0urHHfiȏ+hexhw erritok!xy0s,83633>hthwȶAf 1882-3ll`ew B8нPfДrțޟV߾1  whollynfitouleheoudan; hadotoneynough,rightingenπadministrativekillandb0ontteastfargeortionswasonXrXonab@course.uchinselsHavithkhedp'sviserHYg(sGeneralickndi8officerppointedpJstaffىEgyptarmypr!1883,znowespatcygoverromhartoum, r2recydaymid*regY.fipbelimiBrigin8InQc(JSennaar [pg 146]IrebiaprotecBam:well.nlucyomhrivisuccesse("MahdiA0CairoWPigdvanceoordofannquek!avwild{+.̂HuffeP,ir.let,ollteweremӛHattempAtask3y JhhlؓimadIyzu҈mDarfur.ԠPcabinetqLoix`resol8) Hp ibiliaY:8u;g0Hэ9gainȆzԢ(stooPloof.84m/a>iewfow(laȦsubse(dopolicr ,ritishةwouldvid`Xw!Ҁ1wbidho0egnheEvht@icapitmiscalcuwh[ȋځtun!#3sĈ7?Hsrong[8PsbCont9yytakihRɰԴ×1{Nhٵ8,ut;2jubecaujepaisڻrٙearexpȧʺ(Englᑓ89`rRdytux.hIW.פѸm(f(2ydau!myt0ٸchXeo2@@vekXQ8tXalٴrisѿqa r2mQH.nκHmb85 ()ZwhoRi)ousrvX‰end? X8fabricauجsPgr.

IIth 0fpSg4ם׽9(̍0dh`oumddrawXwnit{un;5d ,zurk#camescue7oٲHЗlnve{#decЇ8loyk (op"mѯnobj()_Ňsz8S\ayTnsx( fa ny;)€ʵrecomehe۷;erXoУAs(Wady-Halfa.Ӻ(lynar,IassumPɾaaatp(QleaHhl+ dɨ,!curq:ink7pletbeXadmidyircumst.t Borsupa8xIkreiXsi.ڊyceaguػ{b[billus8Ufvm鰕cisɾpAbroXXssunAldiulti za!Pfeޞjuy insXes,[ rmaj,mېortpH`Ĝxhjudgrsputgo0X(赑ɝlpinw eustatientlydmitha)eesultsuccessrailuren Evisrmo`yaveimeor,ndllanoy.ewoemarkst؅adepo@facileens8.ԅ0fir(*osehonew:Soud`best@pprovedz.nanuary 22, 1884,ordwrotBLranvilevera kouldaselposs(ionc* ughQueen'sinisters fuljhifirecommendingacu0inasmuch )sacreAatowardsecurgoodpPntfarXonerouPo4of ȃ8nttempti.nobodyBhavis[cJescapeflecSWyOOwhugncumb@cegypt!VAsxh1see, socaXwhenappolicyg,є8it2hashИaown (oOrquȍygeol hKhoum(!iRfefHotJsour8,0moHnnm9ible; HobjxЁbanonXmea81urpBritishroopXaperJHbu5t+minpita@g!)ndefi.isid@certai QlookbnyƧn`ڧC CIII/`

:takQrryaskBxtricW灰isai Mr.ladstPcabineplaQtiHmqprHno`nق.ipҮL2sǜHralԝ(BnНberEkeepel18woHv.Untun(Saȶlohphi)hXt`l~ngufslipxcZdrawAsHPdrې.ock0Wq1decisq[pg 149]Ma/QI-DpatOf̙ok+p>(Feb. 12, 1883)seAhSuaki70лIaؕ .ʹxssavagȽ slaPu uma@arpxsur(aew!lȂ5acri1mu0tlowy(SfellTokaIlabQXpy0fruit.<pos=0001342828 id="Xf_85"T85a>rBseffHllfi@ahdixAnDp>I薣,it#4unsoؾxrhepЁDknowgpiHdelib;׃weiggųpuPf ecl@0@O,r IRvociferPinXequawin,ir (P͍ߍ3111ߍ66>rؖȕb@eٹ80reply@лg j9eauXBahص2ofraubi8dHfrha"utb lemHimï붨vit ablylienateribeshateretillotaughtyeahdi.87nhappixird xlicationromond`Xlastrevapd,ndir.aring,upportedNubar,a2velynoo؆Colonelatson,hoadervwithorHknewimllagreP:Twoul tanf hpgeQselforryutpoxfdrawȈSSoudasuicksssible. #Whoeveroes,aingnanPho@GranveЏundertakeQiceaP`difficult`Hger.This؎Janua16th.wopysdi8c.r.ladst"Hawarden.0bmit1)qu@y(. 14, 1884)ᎉ sorm:Ifs`[pg 150]-a/>xvc yXeral8fluen`exci5oscKhartoum琰iȗ2i8bit0 Suakia8ssuHmiB@dvisTruc(0sorpossG>ojtelegraph]o0Іr0mee 3Ћeapsmuttї__TԒwqre6)l,honHbe)СehavedKff :

O18,Hо( (cre*pst؎)/Nhbroo(ClDilmePS;8nоM;summzsud7WolȠp8Էle nte-pm.ansa{Y!scou(Gonm)x0vacuy,uy{g{futg.׿ɤXq?\]Q\=Yes.HWUGPngw9RYwpHyDhЅihp?o~_%ewish9upjnowCϋOM,OBDiI+8.ȩCalaisF 8o)npacch*ɿuI[ȧherimeinisteradgree8tnce(eceivingnewsfhwasoneywarfice,ndelegraphssen;sanight.<90i(worlXop`f@#¯swIAseizin²qEx;iitYgsidereeccric;BBrockѕ`ÎopKw۷kJ`)rmؗe(ie:8ɶemla@b!P9 spȨircbhYZK1IwouXIbe *PnouYRmi@eymakPoHpa3Aon-@`grbec,)sHsqve觉HPةwiP PxhaIwovntle#g9jar.

KIV/X

ItXs8ometimAPȐmxhiexfollowqcȱx1L\jSuaXȺYrHnt.fg|RSearŲ؅:8rrVloobngSou,te8qejaylbCa8"o˗touma ntHrop"ha(hapXT|ɳta)Qrervishнn؆flus@f(voltmЫ2killЃerrlP߅٪a9oera@hi8ӱLonyPSj$sugg0aP鵱rry)Aevacu:ؔxȢXnor-le.Granvu8@(xXnoģ"velynX՛qcp aclxSn.rrucihu8gy[ɣѥqC֝෴anoA.93/a>hiXetchoɘ!makvastCaI,DtceLo ileb. 7ؗtimecroXertPo`0chEEnglishoreignf.

OnyBdisi,%hppa9aemorxumǒ,whiYopinObet 1t0*ift yXltaPexixYbeч[iquxampmad:mmsoX:fed.PX\rulersleЦcce@yMahdi*srq,ꤘ頸leasadocuImphasJGTIxsdyxH.M.'sɣcqli@vocablci9"ȧnerouu(gtpeopSdafutuh_.̋,@epeTw7fjam selvesAxodxevi8qQk[pg 154]6/>Xin0thxi:(ey2a8!s`; `sػဋillishNowhxlmW,iscaple,Hɧl8s(Psnkonl虙ifiom evacu4`smu@ `crcnssatowaaǘL3faPo–qdm(9niLbeA).ɜ0qm@iimpraq@cos!em|anowȝI GplacmPiP48644I˴3,9soptZѭIS,(ztۻisZmiӜ5ⷈYT8xgb5tފ#'Pb72ػzy8ث菰)ѢpahfHڭ0invۖ$xspirnuob/dQue|Sc[PÿԗhkAIProhedһl ‡|ؼ8spKꝷNobj0!я(wreoXx)slippabDeblisggan o}diffXprov'|6ma 0uik ОlvB`binet nexaKhartou@c.72555>trictXpѥѓbodnnclu2firmroclamҙY technHpPr0IQBona0H2Pۢ[dYcrepo0‰셠qcarrIbytimmod*ouncIiίPf88e*sH׿syelshuж0}x:֧#Qhᗨ poBdn ဈdithoutubstancethedlestontroversiesrelways !hott(for [pg 155]

ChangOfolicynotnlyasordon2la@mannlworldo@himselfoundyfficialstructions,0actudiځcase0tooittlenown,shiftingsuableermifardHfdireeHexowsolve0esatrom.wo8xty clearonhsPfafulhadhpyevacuaɅbabonmewhich a(ormHccepted;o ryBrPsha;dH frend.nhappixneer$tart.K|h3+V/+P!'sKrPHyu.iewpbfrightmbarrassiIenvelop`,Xnw er.tisamHiȐnes,i두ateous!(justexdP(diJield,induxhmeasuccȠcabinethx◻equitمneglxqemporarzsPtory p>HӞ`ertakxamissq}serirܕeHt,@hYcomrad`CollewЌhxwefsupply.ȋfir@؛ r0repxvxrul whe`n_Py,fB嬠np;r8e9YɝXedisXeWreachxBerbQInm hRquxq爍 erlaczs.ϳKtouôPخ6`hHdelXraАnew󆠎0eSouda(rokep2luדohbo.HšFebrua9ehcMarpcⲃ[pg 156]&/>d6Aouѻ

_ɺ5~ruxdefcreczA0`aguppGGim ؾщVcgPOp`j}mbbin,ѧHexpedЖcanrHf๠d}aDtosaccept2ffa `loropicb@o kú\@۹uP໐ȸsava_7oؿPnyhi sasternommonense,thersalltgnoble.heation,tnyatIinnefsighdealisingumours,houGordhadousedomeeelyagainst8mselniountry (unjustlyn)ysecre@ormyanc!old8slaves.

generalnoteenA Khartoum (Februah18ee!elegramoir.arX,ropoth89withdrawfromN,obePashaldЌPmsuccessor govor-mSoudan:&madehK.C.M.G.n(eQiv(0`0requerenu`Y`.AjaiHactxe [pg 157]div>ixS@@ڗ@mowaidmop SuakС1883,utBLonqvetoإ0y`wA8ec`Åc*ypibilityiHdoPШ."!ݢŧTaycaž'PhП Azѭ9upsetp npnchlood-feutwhB reachCa(,!sugg񤙣gPCypru0\kepׅSspiP dZimi(patc%jrmiW,nvircuHCuٺBjPnȋ'c0XeavCe8ettPultaS*a1yMahdihrwork;gstgocrony8Cpo`capacmar ۂaurؤEرIrie(zXhS,jzrbdxrhrewextolxlhew.ubaXo@av cabinhSIonc)Eprtangf淐t[pg 158]a/>zotح1w1r`Jeobjefs AaccȾchBFebru21r.ladst0؊aQu ]8opinqP *rPxkRAmin Y ssum Bish7iupss oenl}@P8seufficiXXgoBeyiWemorumJans5ykspeci@provi0pB`4t pk @ifni rYyield,љ ۻە˖sdA`ll-ptuQipṼpl؃Ѹѭ9pѸindi`erbH3omnip09ȺـsdiPyqpubl؂*ipmol0m[extr-IEgy@garriڴzrimuU5urgٱneYg@G: a on0de dÞuropesc8Hlv*kHcselfnlucy99,ɧsaGwaxsXsibleNsltv*yyears𓞷Ps  explained,outobeirnaositionikehatf@emeeriAfghanistan,sbuffbetweengyptndMahdi,ithsubsidy,oralxpport@pallRresarrangement.Ԅ`ideaayr:notaveaoodne;bodylse 1ter.

It(`surprisingcabthoulPsknewxascomoghhybrusted;򊸂o@omfirp1believeoturnfrieP(DŽrdpxapful(ngloihoroubtsord[pg 159]div>Si1eop(@witself+qpat;ieY(bctuxreyCommImembxlfavi̘pyicWWenm#govern!eI`Hx`uX0s[.̀ Gladnдټtroșpz2SNIměڰgene8ly,]Rrp9LǽvixYunt0te o)voic1ClarkKdicPmyppeaȘ;*javailablanexsary)munHsة, `Harي Nϊ-PA𡉤bedsirsgre ,s!茐Prj׺ayikQ҄ brparwowbelih𛲺z.hef@!ʾXrI) Ppaq ۉQuee(elegraph!a.¥±m8/Ona`d 15W71x5ً ؔcaPvpiL`K[pg 160]a/>SunR8r gro0cI`ђdevxwhijudgp8umo ng:clu)(H8)ssځQoxuss!9خanncy8ndQbonbhYK.new8ad;sohpcMahdiself.jpol1 )z.ȧH!ca:xJwskMsheikhhh0(loagainˬ٘Byppport!haQnexPgorȮnbarguRfunyePat`objeczsX|ou~ntryle8He@dXp8nX`Huۂm9orgargoڜH9poa[fat@oh߮431߮22ߘlp>W;Ê trib@Ktoum8moPbe(rxFmiddMarcXsayHHobser,Pe`vaସircumhoplڽ;.WQ eya`rAhugI𸀞,8atpin-pHtrrisons, mpal!Arab0Premem4StewHUou`vaXempl)8Ȱfeeleviewmark comnse.86133>ngui0dicV`2ybenicktodsJpk1w nfbeyxQlimith1ue.icga4ӫ advYrthbӘΗjm{fe(hMH26paciffa?"rّaoPcacr-htȷ𼱺wup%.SG62G/Dra:rpHc`҄Ibau8nowIregvcxuiwirmQm8Queeliпyuimp,hMpGladأ a @YLerfYkgA*c18lankg`Athixѯrrequ[sheipmnclu)أa2Calf-baroup>[#z)steamesquatoriazkA\BelgianHSEvelynriis;owlievA(bn(m g(()ŗ+(aelegr8),I8wsafԷyȻNѯep08acct;s&ONlnw1Thpgh̵Ǒvэ15)aۻedepȚ;=,*PȗYaoluz@avh,udisٗ,vi¿"aautPiYtȽ@Lals8Yde claredecessaryorordon'safety,ndatrictlyonfintohatbject.heabtecidagainst0mmediatexpPtion,neportantemberowingwouldesig8fiereoteineutumahit:.npril 7,Bques2o mep.ixfavourable,ivecwainclud3e minister.

AlmobyeP8MarchtooobIsnooaRretreanyongopen.fIycu҄ut,il wr,Hm liefpossip?䇀rsfromuakoer^ownugg[s?„p1soldiXff8d.ƀcuprlitt*;qIn`oqmighdX;ve:yܖɖugh.ashaous!caval(acrXwoundmile0fsertmЅ}communica[`sasڀcК`taІ8rbefall,einms@!month8WJbeengsÀguagskL [pg 163]ې>QOfnŠ^ycgoxnqPndwheah8Dolbadv(.ȩQ! rrilimYatal$benefidoubtful.íJa;,ȍ`,cmadis2ardf@Q/`*&0sNHlowXtQlHh1h蜸cI'acnXjufiPMr.ladshayFyuȵ(ersSoudam8scaskvit你S9cХseXnPQqg@ yc(hummeankbprudCaa` 8natu 87755>Pbodyw1vici %Yrtey`s#xlsifr2iriA iyA?>`dsTstudhob v,epaoxwhohcquɠn@ȽxirhpagreaHnDri{r)vӓwekn91885(o `rthr`cظahdiiî8ȺhtroyQsor.p>On@l 14ir.ar肊k`r0wor񑟚Xfђ:ɻ+vo@(ȿp Xi aXontgaz2s8#ߢ,3ykAHѵq;bjYeо olosZ“[eo񚀐isH).x9s؃LolsH໙wtoϯrhicre d1iPdiѴH!clu@e__um.ԇҸAaiȴpmoPimpoлʿS[pg 164]}a/> @on; rupíDfl[@"b |h9e%KXpisA鶐yaccydxmfw@caus8xCcu effectu0SimilZmighailJ,jI“dɁX(newbjug %aumm#Ӛobj!'s1i. JuP27ͨLPBerbZnX/divȀ3h3VIIIon'tink 8evcaHanyharpssue (likei8aboutobeir);a rtmaȆgot(wanted.;|:aintiPhQ@v,obt@iacxmoposi,Fif,render1himPsistaؠSX/a>ycisiyApa%2c ѡrapiȉ`skpڭysӫzWolsel([pg 165]/p> ExpqStXsoi[Qeptem` 91reh@⪣difficX!a@libeenqbesi,addeajЗPW0Pݠ.16477>Octr 5вeWady-Halfa~paignan.p>WғNccsxy ephoic, 6qțwhe|rp :hav0m)sucyful H,`t`*nost gical8r@Revo pl0qua`ѷJalmox@hu/rdshiplabkt ഈ@unknown rjHHitsӕafqndbanRu channelSrock0RrHrt-bg0acts;JBayudesAftealthypem`tryl,zhir`8HX rnspa qemaciblackQfoo8wPrhcxjilragPHrrkadmi{$adv0ipdRobject.obodH.E`yp go鿘wimmlywrirerPtew(' exc(aqo!nugghladpdhH! wȶn ight (. 28)Jrelieq8m[.!e woteamersanlowlyn,olitaryoiceromheiver-bankowndgainalledutoYathartoumasakeGordo.agersearchingithirlasses, offpercepdCgonment-housearecknolaflyp.|, Pfact,adetiseaidaysefore.

Mrladstonefterwardlwyspokbetrayal.‰Majoritchener,horepar"ior sqaccusationsrreaXwerllagueLomindutcomBeupposiy. Inpin(,sX/a>ԖiHwrelievax onNlat1sleadJAugh'o dhur0ouldav8HecهgmfourteRxapeopltix;Rev ̚h8futrooptubceffecadvp86many3P@it!8bXsȞenough HdMahdi, @oimibayn/lumnJup/divЀ3h3VIIIdissҲ\diA`Hmousns`㙏angtelegrambla8g8rȻhߗRcipYusual,Ͽddsan) ( 1885)Rίprs8@n`b9f:cloPuif Hragic:ϧ!Tn +!h ²oh(oyeyMajestyH]ͼ clair󻹿dorabelligedy from[Wolscѵstoo)i[ ghb,xyɸ€c)춨s8\cϑdoؓqsuH0imat9(eaHjudg!sc(ot8ysainЂhAlX{mgoʾxaltogeRfowdncluHichJA𨁯anpunHma⩺X[suixadvINسargXoȜ+؅det+(a3i0s򮀿(JrxXupex `lǺr@GHoccupyerbwCndQnpeakowиsubmi)󺳸kzde0sua 8Y,ꇜou1chثQ$periodSUnavigONi u0egIhwHnٹThameԙ pg8Pro.¼Hwhэ\firHsymptom$ piǍdz8w!secure,isxs*HcompetIbylbtaPx<ɥal¢bouthority asecidedlygainstt,ndhe afbSuakinBerberoute,ithllsormidableifficulties0hentert8ed Xpreference;oritntiluchaerioatweightopinioinatwarraxCdef8tivehoiceNiHB.ourajesty'sssprae;cliXeZdHa8SfaroIgnswordenemyvyhemthproviding <:[pg 168]adequmilitaryean nevtoos@romiew8mha oqstrucҐ|grmyioudan.ɒ0sb@buntradigni@thoccaspxXp em.Αycomplfo!should;aartialXnsomay foЃxle(ngSneЗ@aggresspolicyaQanyrosxrrappؔ뚐YendhXmarkseHf79ceeAyhich,؅0atP9honHy'!pc;ks⎨s8PreHr.ladstonubmɠ2humevoQPtaket힐Khoum2fP@thgh;xhaus1.‘tob@Rtele؀iR0Hu8o`cordpacc8xҤ8`WortljdelhЩtowpycaiyܦHsomeviouWsǡhrGXrim;2E#nexёlikeo8quiȒp𭨰,:tiHali蒲8.ԁ0qIwu@sugg`J, @phapxvJrehen|o`BrsHpoi,h,OJ6assuDɢcluJeo`(l rrnmZzᢘԳH`furhhsuYi[thFjudgxsurirHܻtp,ȧ ppeo򬨠ȼفreemoXopposr,qhsu،s.morem;aŃë.hkGAc1e侊mgu@sinrotEgypعPI(a MahdipruurḺ/i"ad@9,8oq!sibayڷil)yt.

O8w WQó hXm`coaȎafȴays:+! ?r[pg 170]6/@pei="4em
#mbp:pbreakxh2Charؔ`JOfԚC. (1895)iy5`xˡsIsopppYQ)p`MGladstone`life.Z1iou Xm(h0ad@`erfu.leep!ndinsJorer(hus3(a{,plaxlsla )diah9:hpȉ&cl dsa,ˇȟ pP{ܝ@dworkrHIŤTlikR ed.”`too(HHunB(P]<9ten0\YeldaslabPdȱ(mferhIretirwhoc໩$c,k:ublicxrvic`le,kГ; O[eleZ7㹸p(xXriddؠEgyptific )birthdaygdozeccupaaays:dAttwoodcrafhelp)b;rm.4x8rbraves.eA"aɂhee;now˩8ȦQ@askdemਁQoufiex2ٴpg171gpo/,-(PhyroWAvMqperplexn)uccHpromsӚZhѸdorganis,fsÜ\p°IfuJanu20IchLondzwo іJP!ur)HaweimmHؿГahtrdǩxveףs2,*οHI @9a neJ5-doAoB runs_ -dRnЧNh-W@ern lUspoilڒ)ial;@I<83o-H@ptqep@xa io. refer騴difficultie(Ȁ 4e?grPfullyȡ_packXledgcsideGsaiӋXٌArupPӶAkؿlibl.uHiawxvoQڪaupI XdyousYe-regQpڨ#?"repHѽ9s.irsؙdmi qvariasympto@no tmprobablehereayelanrntentionoreakpiarty.u8fruptuof`atindomes,this myecosenceitillR؃HmattersIprinciple,nownႠundtoodyZwhocountry,*youruty

r.ladHp"(vip (Janua@30))f``8DukDevonshi(w@erfulwell˝asx,w،eLor_+Igep[pg 172]a/> xtelegram (Febr*5)!evilw4aXKhoumsIhunhowa 's@t,wuIaf@familffect(ri0philoso8c+observaonlЗPAcwrXhihV2):S1cY mezewAliaˉi1emocra8XntushQbePdifficulXusrmqica `psiex uhripد1y man. desig*drawhiH謱urgpneededCmpAf;tippresapopulpexcit򷐳cho8y ؃<p dang8tcica0ra( becanoboʦu@xdeaў"s, mHk#֭p+I(s \ism(ncsagogam*enllo )cicРtyHhٲ}waxppdac,w-ng,GnM)lؘo6Pppsex`b8(rttachȋȪevirpl eflassnterests.heiberalismto-dayset@phataveescrdsnnoblingHoldonservatx;ay,uchl,etarromgood.tsidea񃢂yalltruction,ttotak)oRhandsrstate busineindividualan.othSne rRrange,BhadorY0par0But,iYthisso sipeven;opɋwhil#comc Xgiunduncouragemeno <:3NJׁE'Xi`ibe8vibɋec,acifIlaw-regard1els;sejusticeQxab@enHouslmЄ*nPrnowjohrfieHJ8o(.ϊwholIo(to׋Ӈ)mitigEchronicistemp6Qm( ibr`yabouncu葰vulsaa2.oueʖreeootmy`iH.p>qvity}lef!ng؃herhapbQgeca*membarr@ ᠸirigh+`i@8e.r.hamlazdPrapid@advanc{ucpncAwhowHr agi`P褹HLorѥonenŸ.psw(January 14),saiXntІneXraHwarn@ aud@plorȇ0@remyurXoPpooHAXmlo0Pnmx)almoDfirxnextli(n0spokɅQtڦҦeKRpriepl Ё$taxزbtoterpayfreducGladst'ndrawWshuierepliH22)mough9[pg 174]a/>$to[mDXvarrpoYobjeese a0definippt,Iba頃၀H𨱾titoerfalupeaker.A`waysrri2hxзəby|Bir ncBbolpllot߇!ayrmeῐhoopuff alsdvx!aiPXК[8mu8i1Pcqulh duime-ر+k1upg x؜ pវ.ԣdelescXжunfnȻڔa (8oelfu,hĒ5rnt@dPnC9{eff$$ aexnjm hmeoǠhYrH31):ItØe°Bx:ambarrass @si9scPshow pled2sonHiؽ"LiPfty-d(x:impulowHtP[aguHezghi+:r(g@wSbin♸pIbeKwAol 2dxЅxislQؤL[xfic࿈ɪtRbdujinergespirit ehindhem.ead,oreover,uitenoughooith [pg 175]

Theeftingpemandsfresent,partromgnsateremiHsorfuture.earXe,nette8oordranville (March 24, 1884), ၈mptePfinition,erhaps,generalPestpolciaȆe`0yomplex.tHanyatcharacishisubthyQ` righȆdrawncs:Wia`is!{cabinet?nypon,pffnceRviewt8neargu0d edly(r(d(daZommHconclu notle 77et.'(wn>ByphraseЙhunacdA'!Ir2ndyimmedi8 was8kcoMr.israeliePÔeҗm @s ɖxeasnjcȎBҝwo=XtorGladvؙȄenow엒owhTurzournthstwe*eegQliamH5all-gn,tworeAicultiMwntEgypIrelch`irlimax)carP[duth iypebJ)'!,̗ H (-;mdi@posiML18t(ha(ak1k0laH4Pictgx{X_3oH9;ilts%GenZGraham'solepcpUnw[Plinfrom\I shMahdi @ݝhRHm a belangw`upwbqpdecla0H1lxsolu)CosZ"nѬȺhim_^Wilia echpotisfi忈leH_]nЂh:dfu>ӲXm/a p>

WѲu;w lleagu bh,Tw .[pg 177]

NarrowscapeAParlint smascratchefHcord.o@wQciplp,(bine`ma)o any rm.oual0take b@numbep*0againHreq0,ntil oke.ȎO@؜8tgoppteqsϝ˅).Ԗe(nPdecisp>ApPْCooinmigenerconsidX !0llyuHhahihwr9QuY(Februa27):WkgYbeli circumstadepe(TowXienab@89es0)soimyialHu8ـxigesSH8cert`XuУ0Њ,"hfroДescomemp8i󅘬#TiPXervhvhbIgoduz^c(espʦgHfm)nexigonzsibɛ8ntroduca iodJnew |mex`ɢXushdzransfpo i ضЙ0ϦʱBr:lefI aXػ b)ar2, 1885vJD нQMrspArnx,p9haln hr+ho!Jÿho sxLoalxngypt2sai"hauf@i7udifficulZ)oryYX1GкiarimiHke,oțsud2worktook.znw4˾yppH binёHcurذciԦALm!loudAgarؿгhorizAnh-w≰yQa#I@38l{$dHrS`ɈAbviouhtRP!ciiYqisrrsusceptiqr8d [pg 178]a/>1skGr@l,(itt@C hapȾ h)sh@kdefeg *ZobligZB(aRuaiAfgȖncaH@add!ygnaanxietys pK123ab) s9ac lhxc(͎{ȓPHcr!ǭdºX,meiv`juncjo Qrupp؄L` #wouquPbud!xPprqcH2?0qu(er;9@A엡ishɎ`apхmoPfu꞉ 9doag vqas.̬re Hweekzؒm* headspoplleagXr:A n🩌$oibbodoHxppؿQҞ&on$ucny (myseIz,,) a0arr?)td @uPe@,ir(aprgX arm*f)again stature,ndearlsoightinggainHliberty (suchvasheasedmits)nSoudan?ԁ@assumptionsnhi` policyadeenoundedallrokdown.smanigna,psteofЅrpilyrushed,ta himselfom8tcouldot 8at.railwayromuakoerservadvanceIKhartoumautumn,ssib؆y:ime.?WSbefore:hseaso߆kc`.ordol(eyablqrocewithsesentrce8deratdi,al as@gwelvyHbattalfhfantr`Zapororms.

Mr.ladstone'@wniewtYcris0PbeXPddpril 9Pirculcabinetre(rryseuesjcamepzfinal`ttlem. <"[pg 179]div>ChangefЙRT2sx8si@*(13-15)evenjir( @`a8gramQu,aaormYYexi 0QffaФ)in@erslzexa?bon:ffenop Guevacu%ritoryk$0replɯ(8Ivehdrawal, rCH!ecءIndiaGoughomg(hbullh`s󁈮xYoPspot8 BBPyaZcbyover iٸH.ocudee6rHsymkٜ GBh10 lueZgdlace;wbalf P@wtook8ho Q1tigh0de0.w)erhapa@+exerwaa@trxinclschool6AbxraQny[X3r*com8suPupaO}oo89ok5o5o>+paspft,o(isdy(March !2Sirenryhnsonby:G[!Evelyn}ڇ+caronhdclarɻ8d Egyphshuman@׵beyo(zroc(TooНs Ш@緩pacc8Vuㄈa@rwork}himhȭ-reImiaȍHgrudg+.׍1xrdrupl<,Qred:,HvyYrQݺ k[pg 180]a/4G]hHim .¬nᛩ`byuwbicى.ɀʈZur0)lli#@ adop`nsЭiȠP{Bco`hRnncsnB8lia9.F)

B[tcX l:ApᛟȮeؾ٦ !cuxnboܬdKxtoumXip>z@Xda㤛g!bsifQednA3htŽjtaktiH oo x#our ntiӣB1?1lefwel yredesig3aurpotȈ¼LNPhe`de8nX˹hwhe70'ZlfollXڨSalisbuba(oaHe  wasometimesressedoeverset,nothrowheervishowerthartoum.oymportunityfisind,ordalisbury'ss1quntil 1896Xwa0ing.X

Itayeh Ȃ؆ha incouxqcorpondenciQueenhangpolic[Soudan,r.ladstonasuall1dulghlux`Iatoricalarxel. Heustssureajesty, wralosQsentJ(Apr(20),11leahn)"xcabinetnowqui8moPlabousorconscidiscu;82nfitZbashac jotmՍpubiew (which,@sQXeratives[pg1]a/>KGeorSiii.e@8nr`buepviwhonihteempirequA mfafulrvantpad`e.divAȔPON3$񋐤h)u ulhelp` e)drХy㣢v@iHฒCommo\X`gtoou0ibabBssfaǒ,f knowK.8whqop 0smoѿŽoldm ceBgndenenispeeq`ׂᒲg ex͞ghaodbeaPmFebruaH27, 1782ollowed,Mar4pXdd鷱baاӁ)ntkYm p![ qhmpzfrrPLsiddϿNj{sjes(։ljǼ;Igh@hapkIcr Iغ;oЧaů%ublicMy׫x3 b`fă ihBr6Sou'!/div?kh3III

Theeaderasyhisimeerhapsorgottenowr.ladstoneood-humouredly`monstratedithordalmerqssociatingim iofeaschoolCobdandright. twentynhven9years drou0moreҀJoympathythosominomrsauses,ue80yesslivoinconenclabel.peakMidloXafdiluti81880,ixcaallegpthatialsiberal powwoul*hAoves(ipcountr0{Manch 10688畈AbhorrPelfishnapolicy,Tsaid,frY`freedomYeyTatta0,mopson,tJgwayceOԀĎce-p@yXsprupHatKncluswmayɑsi(0havclirelao is(blePr {affaiworihɠЃducamepddap!dignimasuiږHڣȡengqw,liklȢo؅Udu`ulevil mak)muilbeǝХYinfR@fellow-cAs.Suciewahriou@rroraqonspect,8荹 .qٔYHȝ)mayouJ;qiԄ@toPs[pg3] a/>8bexcepїjr2JtyP dotatlem`cuphёҚYpadeplorecoc};dbInecitԶZon;Taa(Ijuxrthd¥H#Prequi!³hkظi bil$untsm.ifZR,o(1Y(igmah9799p8p>IhsofԷHᵀprobaWmperfy܍*yiحBnga¸ڭد1+# h@߻quс #own8c0d(lsɭixlXdnaEgy(tra@JЮghtanger)r1sѰ8`uaregarPP0Afg ax^د8eɰta zyhsqefA,:.warpe8м8uaڲ0haadv;C8A88gRximyri1Amee€isnnappo0Rcomȼc;divibbetwTurH{nexKÃ@ura @nYtpllywhodoЈAll0s`ihwP@82HʺpآhhooпhEwilȚ0m.8mudPbpѯjr*鎹,HC ئSouؚlicyood!m lyithheireader,ndhenr.ladstoneroposedotefreditorlevmillions,whichixaalereem0`toeet Hasepreparat,

<>VqOfúrbʚ9LAGv0#ȱHiٛͲqd9,0urfomselvȝ`ykhwh@o(hdbeBaoQus0sXPdoptR`uMhfʴ`@Wj ifiriumph'#sih oul0񥘨RussiafKn`ho8y٤@I !@itxAfghoccu鰉Jh`P1880,GXseJsu0asdva9iim‰(dari)q8imm(AneHo4asǼph2fundKЃx,adooXH nyinvr;BUoglibeor.[pg 186]tengthtingeXto nsoesotonceal burden.ors.ladstonewritfromowntreenay-x:

RaPrppressedndirPwiɇ@magnitudecomplicatiofubjectsYmyind,id*thinkA)byfirstost,twillwppl3omissImakusfsed.s)alatphiry[isry,hic!wnhHi(sixyear,!haseend apolcsiayusucc hairbreadescapQpacciB"pa@ ,ڑHonZAnumb!fxrsaveathrouglth0caoen*XhopyȂ5wyremaiSome(agotqyou;dark jkyxڊ0ythunder-clouy(!sibi9Xadmirabl蔸+ulX f8me/\nd-up`t thIhu҉RuaIrelatwo77>g8t//Ӡhhl+Brayn>Ieso0noHansxco3gwҜ`riousharac;kxsooxSap2iIrishϢȑSmo$>lth ddxtheaviagour ؤzward8ediissf@ner.Ϊ

O 2s:hloo2ictuAcadem(LoGȖhb*iidЗQ;1sХeace.ȧkxrite`aQJ3,ӜayDiIxMarlboHpPQm pleas.®k1nslik+unxtful.8amuxfgu bbody.ٶ8yhppN4 4Wroto+Spe8xMr.halir.ilkeXlH.AC., 4--8-J9--2-poлHUquȓy@MAknockXupOv572..x,[tɰ㝰c[:af3پ`Ю?M14,8cenrDMYѯQsе siivieweavpbBkeepme^cab𸸐gG'SC2-4iAffCulosbrtgc[pg 187] a/1)StaXOf(*gg@had( кreearsanhurIapniged,P"rem`I ted;nspiraflfid񹠏oubH;cieP1itsgPreex0nyar½Y8tiHidixemerg)&h;ڷōpcYRtitudePcou0vohoachi`yeexriumphҿc("ixfel˴litaXykzardYs`ig( و:lf-,y) advaؚ}l(@ )nP⭨ˮhopeھ0l,sbHmal,hPHd@,p@nk80xhiA oriwiHmisgivS*ijs'gnPhr!abgnmɿsha al˦80mMtooactPcribPaat@th8s рpan>


遲mbp:pagebreakxh2>ChapterI.efeatfiniss. (May-June 1885)Nevdoounselsfortalenhwart8erderedurposfeus_8h3ߓߓIgd3Wh(wasoeIrisholicy?Ԅ@CrimescXouldxpirenugust,ndstatJp(i Xliat:xsectionsith0icabineXtogerBapproachQgenerxelC,adquesh+t shڇ(rwedipo xmsqssucruciimp)nce.w)goodr`dsoruspngtorAj؇jntima3o{Lalisburycom`officehheydropercj ɒHlibsaCpiȄYcc 0likmrelyp8;X/a>fqrH ot)`makB`fknIrish,r(e1sonusuaQceedwŒinscrutableitxd8em?r.cCa0y0tʌ"act ler,`sXhdircumst how eavourobtم`gHgPpcoerc;+woemsorXPonB)؍cognisip,a@iuccplakjrstraightromordalisbuerxi9s{xfou*ssuce(ssfh;askeach̛gleurHiffnZgoack pfuHques<;* DRg7?}xhӋ8,|brouar!pXך787ך33>ϨB `h,!beuniXdenipb+k anxomp袩򜗢ZmXnt8l1upXHa‰٢ȩY!Phixaf,;8d8oo slipydәr).ɳЇ nmKaxڪPHz@isdsolvsubjeYggznvХaX׵Ѳѭ"uHicu 쳢)bȎParnell.

IILP@bmPpɐ`qlcab(HadܤpeجX`h1xew詜C6balm arcil!imx@xelf-go8nʾloxasadij rJƶ b@ʲwyieilxCP_d⒧tagre[msmaeooo$Cpa {[pg 191]a/񒟒-nMGÑ@Gp>crboaXclY|impoXadr@funRsʓo@IXHH0*Com2-airitrot򝒡.RPdea̓elgangwa8B lyaarlih8E*2exثȅ$opк]-poy1881p1giifals;m/cep1law,%m@ir詑`.zGladst1у o$Qu[#s(8t/󉖖H˞)K0HdikzspegĹ r(Q)X`ceeьС)ОIapit RtfuleaഁbPtt(ip"xk@hl(ѯp>Axmorumy_ZzئiJwQhimɹ"G vXe (May 6)wRattituзڅ ,`rrsy:7q..؄pۄ]gn0ledg(r'mypyChaml2owXk`opТb[favourҼPHCBⷠLBGऔܐxlba.nircumsH࿠duX (rnѰ9xqea8sib accQd|ոIaaf fairsashatfrobableplit, indepe(ntly4Cerlas9ptempZȞ:Ir y:onnbI8r,ILm hojatRⵀYlemjB mXepbk2cabineivehHncHQrecortڧhbroad.̀GranvyhiXpdJػmusoIR:c /@2Ljmh (M23r.ladst!wroarht¨SQueegػH|:ideaMshad fixL̸ref8:egis8Q .%HiItsir9`0outlАkppecauJubj@Jڌ2豮p9ÿ{exerci(o`imIflx8gurffairsoTtwo ы#xergZ2wI!ipd_ lochgohni.jvro0&dropa8rw7QХco隀vi9t peؐfar-e9nlaw.ϠQ Pdoubt(e=_؜q`)IcȮP `+)nbXFyeah(ncludٝ!qbS(AAYQ+PmgaChalSirrlDilkpueAtUhHaV.ex'#,he8:HimHpr([pg 193]a/ܦOInC;PrmOإ3iq`XymAreרȰnty7*\Xb boЪˤ')ddiza㴰h  ဈboardorllreland,ssentiyunicipal otolitical;nheaHexecutiveJadministra,ut soith(werokeye-laws,aiseundhpledgeublicreditsuchodessarliamhoulrovide.ԅcxrw tov0educ8on,imary,тQtermat0erhapsvenigher; *sanit0/;Kworkswholhar@ofusIA:risonsreb yisGHbeirectel@9byIhot,chopurepreountyÆxProtmore,haтp(dXinctromumberhp, firstdenowor.ladstonCha)l,
I6HaXriousWTbo sؑhy}LAPllIa8blZyselPfБ= qrsuffici)crnx.mhit wiXrighbcq *kzЊncihal#disclosmvbЇ8hinkLnow tw)cauPplnȔ/tȃHrdfantuih4sRidmf̩gxaun9qinflYyult.IIISt??ltogeIhclS1ownhrPhXYroȕ!invȩMeanheerIGh`s [pg 196]Ea/>HawxeiinLechlerWyhD,alpoleGeo e,onXGanCoop)kAOth.mo8@1Wo(r,tr; ش *ajZ3m1t@ĊȦ ~qxdo*k ,,18sgр,8`unwelhx@(Ju4)"urD0aSt` Be (,owe ,serЛѶ!ncrispahH80:ZTGDaE30, 1885"Imxr@Asur8cyouXˍarksXدx{rg`yп(u`labqanxietrlmoxwh hio8ry,Qticulyyؤ8s8Cdefe Hickx B/ aafy thPNmoBػ`Aipѯˬtoum pegrolkJ긩oxexamAضغ9x0vi%rsq0t𭧹)Ip%a0,Èzcol!jBa0ʸu@etpp@< 1 m, ڇoshduPayItakiEgypti@qqpnWisubbetwAIASoudaIiwmwoerro ban݂KHh:ir`lp <:[pg 197]hadisc gbeen,Єagy0anpSoudanitasmpossibwit aryofredsatisfactiowebeyoȈstrength,jveunwisBourecessorsisadducountry./pp Aiso woreatgdesratauR:iConv8Afghettlp(evacupȋגhprincipHai1`implishedrshoulјXatfmpiXhabroha imosspectsusuPy?orbomem<oughPi<beeaF͊׊יDAYcon*ques8aewmpaiveȣ@tagpXgsol8onoon>Nowreg`iXdiatubj80ifha9lxDilkesou8emڒ(,aY^`robbolocal n*XIrels0pir!0*abht?81s9]sbmuag蒠miއ8uh!peptyaecisc80Jturbx.ore,grHxyRweakrow;(hpasgop,ѱ:godPm`_arHvLPurb(Ϥn>IZk9先ttakPxrse\tXQgnaNoubh\qЍartҥl魑iI x;ԗweffjTzcowyig i.orgiHIw (`J frankn )9h ewIrEmۓڛam c`X?ٲѸdiHp twemrػ"FirPP;(urByIPHedhmٻmbegkϲϿ`}жlicS nم>>{; :Љ riously9tXkf{MaKParnell9nokҭ)CtgoKӷcilf^[pg 198]a/pI=PitselfHdeepOMu (e)i2Sanisimi؁ssewq,?e.gDPScot)goodntD `ireaymixzKdvagnorm* weigе`drawbacksoon>Ayohe akqpPfѰ_ghZeavhf`gŠ@H;//>nstaffajܿafissolusXyoduinؼj(H"ƕO-oyxinuPn>O0bctuaUhypti`g)Chamberlarief {ulsSorkhim;w0P0ࢱOI/div?kh3fosize="+1">IV[pg 199]

FinxDelibs`iMr.ladstPaH!hiQuѤautumn (OctoȦH,ɐKn8YMajesty'inis:τTWn. ...ȫp`ce@XvariousuarHreȥَqvHpS#dosquny ewofsubt a񢍙ѠHzBihdefeظ80caujh)rn>'praysэgraXxBrempi?=simp13occuҶ\HA meeəЩ picular>.ӋȺѨapettZ(=Ina还YhorXtye(ؖ/>1١|Eə]=oncluہާݸ N,qЌ o`l,safebPdWWn>2.׋ga̺rgrdesbPHedu;ȍn"u1oQ0absolp-F,@~vioȸFemp!br;hRtog#e8l@setn>3.„xHoycot (񺘼 P(ynz`RBthം!exec(p&,rꕰ!9c /җ instruY0i,di8نXuH餷.VIxh9i!IQyioh@omitPafAìٲ#ahmmunic;︈fd)yr ( 12iusУxd:rdilbɽQb1fapwayy ؘ'evc8sradplmXv@firmake `a0@fTxc`c yh[pg 200]ua/>grnIyȀxthrow(PR-Yy;ᘒsummar3bIheujRо9 0iyL#Gܰ3{ȶ|aaHetw:oriiI@:xst! o x0믫w|budiclouz*bursoughAIusuvinci1adyarȮ9nxbidXodIdevil8 zm,  didottronglyelievenheisk.ԀPdiaryhedsight3statefisxpecions:

June 6.Ɇ)dIloXWUmov SirichaHickschtwoointsfatmoer@firsx r(dueerspirix)outrrespingޝ1w;9,e@fz%lroperHwhprfgi1HrsfiscHissu9triaW minh!alliabrouab"esuliQdefGladstogXrnjbucc mbetwrieHIh carmportlicpart1for8Хc im8hoPBp0cooepAbe퐠c:(`is%cKخc`ٮinsu(cagBppososeM(workQthygy,bZP覑iб8ividualP8duc4eff ;adʕ@gramMrh atcK[pg 201]Ua/gfize="-1">BbXjedPXXࡀaascPllowjaaJ8ܐ88Z9sx(ngormspeecsettbe e(d:ƼfПiɰ8s(tlydify¾8hr0MzSPl_ fmRApt0uH-nst LouexatўAosger ym.׽aȿ@mRta kenheormfodestatisfactionmonganyiberals,atyouldoXntryithou*bnoxiousabelQcoerctieddQirecks.sinisteritashserv"if#streetsouwᅡgl)particularlylaspep0aoyfulramf [pg 203]

Resignh8Officeenanceon.clo؇ wfi9㇠em alatabinet.Thialrisif 1885unusualproed,ʎcurY. avictophadepwbycoali 1Ihh;@ru9on@beeaph2bupport;ʀZSso da XmPngncesaissolugh0olegimsibl(because)retrib#billexonXtuencies"moadicch9dawli8chpn(syPBseaPq(nchisevp@نxЌemptyPslC8urity.ndФXxcircumstQXso0$brgu.eakoZ far thmMr.ladstAݦHPackkleavЂ$g ri *iXrndiff؆Y#Xarrass葡b.ŋZsoyoepprud waIselXOPrPnbulkMϯ(kÁсӬ)kapo8_z vHmboumphv!nѠshrinkoqiL@rag(friends峭\eleonfl wpidapaxeumeanwhHrsurp (Jup10)둏)s`8madef vit8quhKask9he0a8Lordӧsbuunw`9{mgnIkUremainrepl+ЩtwP0ttXbud,drex-suchXd`Hhf٠aevAcsrؗH@1recet,!ܭtaъ¾D`1852,u*undoubteѼJweH0Iǚًﺯ99255>ɚBs[[pg 204]a/>ߏyuoccepsHi#ac.Nsedw pansITa(fusн(obasjicjrignjs1)sumؿ_Z@Bal/(Bann7sext8Rrkܗrimq0{0fsfailuȺ0eek[oyce.'sp`z1,ewcobPo@ZH@`lif1Lfut ,lAXughX`slZons䟑MajIwhoidemisc=ol؊limiIrsp@!mqgp^ؒol9ȼnHl nPssenI(firaudнhwst򬛌Zd|Zd0rakṋz;tђdiulti8@G ї̫d,:Aa tmajor un@xsolvk@omHd׺׸9inh󁡦dqϼȦX3Xregar{߯sZhکaPup!ibesef t辨upips ?er0dr(nXatvalu˥ qns(leagȅɯ|re sumptionffice.henordalisburyoughtssurancesMr.ladstone'support,8oinY,arliamentaXtimandtherointsn xorkingexecutiveovern seOseiBwsowemper,orhumourhisriendshtyfdemberjquarrelr1spfႨeil8eretYhotallowe1mgЈCoundsel`sprecedȄcommunica*D) 1845etwePe8!Rusl.ɋdefaulw,ththatsldXIQuAnosefulervaSonclu :irstage.

[pg 205]#Ministerialrisis-/8>Tclspeciledg!xwrotea(Ju17)㕼duc>nssqbusin`untry,believPwbisposiښX8Л`r퇬s.?:`Ėcolleaguzuiinrgen`langusu˝(`regnumtinued.ϝdayH1L8)ϊhadudБWiowhkqYreturnqItree-و.ѕ{wmograci1AI~reasonable.d (Di)ȝutYrrsomXeZemodШHr!c9èA cheilyptach8Bvaluh:hmyp6 ,-holeBuar᠘Xtircumx«mi 0lxdep&spiri†a8aken.ƭhmybYYSQI8onsХZwavb pp2ohamad8:gW(d)onfxڨqeeaTrמzûL Pgiriiamark8ro,Ȏ2yno!mmYlit8HC Pfur"qicuHp>јhargyga(tҳnegu`\crabп۴aXyPh uХr20,ӉHenPon@c0tw̭uʿ0hh:#Mk1.è(Wdnygre?##IsId,sou0k,Ioccuɾ lp/*'oJAXNo. 2yOm۠:Ъxphuqud]Toߩ judgmsafyjiva}r刷12fgbailmڽreȋvrdiif.ritukalp񒲹ë$ go8.³( H?ٝc[pgp6]a/ͪexmootamں q erArishHǼinғcceleȽ9desooٵpbًibeYlef8iY؃a(P=0001353632 id="f_126" 26a4/%O@@viewWSlucidt!fowJ,xکИئP0n(k1)FXletps (aw)ȼشt`Xima ;Bb HsidwininisZ1asksibfxIilicgiveǠn op9no7demqf8IL8madq`sextrUe`Yxd qu0d,We.gmirx#lȪpla beya^iнhH!0as@hut elynheowerfjministersoePenhategislativruestions (exceptupply)Xhall8Yttedg audgment.ԄHHousXfommymayndught8dispos3facilitateKrogressanecparyus0bxreasonableaawise,toulde Єctouwhich؄HPbeforeh!xiextincqitscre.

C(Prolonged:QueeМQ p(Mr.ladne'sHgg JuX20 dJexYfidwsassu(蟊jOnBڴ򇨵selXr;2emb8ఈwȤ | th makhy sodepHiѓYЬqwfлQdefeXdovernmtwoCSj'!oes x@bev{hayn0etaehwi iniclRѓremțty-eiX in ȻгȷмhHatfie8t(markseagڄregnumع2 sddia PPafuСxvicitude.nj edfe @xu򷚃(Hen@Ponbwh0vithjudgytpd{i(nid cacfwar0orGv٪ס4068ס88>ЮytpWidrYaxt8m8wrin hstqfyBJZi`Ployaץӳ` hl8xr`i9踨 ssxqzwa(t.ks8lsubm!/);dnd moȐy,lacJp(۞jaBuOvi؍ʨ.ǥimmovA¿Adec0Edض y`ʎenesih;Hrp!rivatrurѿuwhip1 lI@a,`dkAt 5.40ۥ4].yurIfview,ڟpZ ypexhaud.l-8l`XQwish2back+[pg 8]a/Imp жHyrepsы@Ked,arfollows:TAi#GaXtu;;ԚIWaapطZMajXmoowp Рh PxJjcircum AholdPf`o  bfȠs,qquoadO w depP?m xleoI!ove rnment.hinkeillowooindsor.<2June 22, '85π, 6L Sp.m./divp>T@nextay (k3),(eueennLordalisbury"letterri@nyr.ladstoЁȅ1,ontainingisp`hatacilitiefupplyighteasonabberovided,thoutlziber5!Hous0fommonsnbeyance,ndurhr,declaratƌ8feltre0was (aa9holdwaysmeansׁdangapprehen2iscoreXnorwar␸s|nxss arnesesirrolo@riscalculatkL`b!in`hsth;:sUh`Ўx mmunicvaccept/)'ssdefPXreAsrom7,㏪iuth akYfiٙ mpar̒PirPpo@a mpowRXp05wo efSrupbpZloؖoranys.a>1review.=Iepisodeannal+system,qm8sibloobservignipor;triotismsub"-0@hult markфarocee1liR#ovr虱mXЊ/p(h3II

Toordranv@n riXqrX sameay:ÂHMr.ladstone'ӡn@valuccuq0-imporAf{iv!hretSE.ץQ#June 30, 1885*SiїC (Borm?)AQ(phtۤTury]ammuzzlџQYHzunbQpl(rgmIogerʕstrqs8dirag!anyelse)iH8.ԭ`tYrkiȗqualIdoAhonp8ڙriec ʅl0rega(즨exҜ{lwaysmapbyAaisQM˳LjnfavqI:dYڋco0aguŻ0i0pdmssiPblig8[pg 211]a/>Arҏvx0ڃPiihsc8a.o}cZdm,tilq0eȿknewa0Xex dHclonrelvoluZrPh9trengfeetthus XiEȻ 5ch3III minishaisr иhAsia2faCI sP CarnarvonHstr ,нpwQn0iѧʱqD(pen`肼broؤgțlinesspeeXʫYȕaӢ9pdelоmemoʖiodt w3nciЪlnsy`mD+sZchx{orOu9Csre-ctHhood;(tbo8powᔰapse?Awythre1Nobodh҂b*𺈞irsbecauHsoxprovis)n""pscex#f 1;ag๐йm ip j8wellrdiypwٯiȴќ1orQ(mis.™xrnZvenu*ecvugcijx[sɂ/0pҵquiqo@3d̃SdJummrgsmid۳ʋyidJ9unPstial'pHleg8Xctʾ8x8t`ru`Bpqc8mQmy{=s pXexcep!i slation.eadeenookinghroughoerc0cts,entinued,ndastonishedoithatverince 1847,ithome yhortntervalsXrdlyhehng,rel[pg 212]2livundexcep!albkveegiW1saneanulddmit(isibetisfactoorwholeJstatefngs?ʂYnoIeyhextricmselvesrom{miserablbit+aim )betXlu?Just(ɎhsqinnglHlXacrosXseacombinb:)Scotclerso8ger9loy(obedieYlaw2qwn!ribY[genlperit0uxy,can8cea*9e panyrreilBbarnIir i0h!!X/a p>

T9remarkʖ u,dݗQpri8pisna0neҤbknЎ!zcwtak@n ni,mH]olicwhi`Xgnutgo9ArĠ`in8uIim!rule.ɖHoxepxèHadva޴(acfirhhon becfamou ePyhs(8ᄞBugglmoHaermb( s[tib⯨our|eH]mGiPUbeAJzsqcapfeCdahY SHhfHqwoupd"emb ԿgiieHRWȃ@sIRAh!}rtIⶀfy(mporم?pyuK[pg 213]n/УPdem*oeath{ wy-onss@Cpit8䴨Ȝgexecҧixsavag8ugMPill'8ѡѦX1n PodnahfudiscI+raiefRcؠxѶ۶Ġcip؊1XducR/ltopicc;uss@occupˆsitt`HPrevcto8S0yUju괂chllorMixjgн xubxQ nx0o:saiforr lQbeHimҺebpm.o #0sa.uIcidy)mark(ell romheovernmentxatreatedivelylarmnoriesndeepisgustliberals.irichaelickseach,Q@eaderfHouseoldIqwhileelievingordpenctoan1perfectonoursenseduty, 8masay pyank0reas(chbIrisholicylЉjougab(c*compleinformation dido`ondemn,s(Psor@makeimselfesponsib .X/a>nvmo8importapminismphasisshnewE.Iille(you,XiHRolphhurc lowJp1s1edoomoailure[pg 214]6/>heyXp yutwunnecessariossumneꎘo0itt

Tomemstp angigho8QthHpricalquXc21h؊ par`waiol1attack2"u'vixobڠ{judges,@i,rlawfrem0YHagaiheZusanim twosaArow୘רЛfDȩkeeearssaSpr0CެР8hheQᖁC k lif0AdawithnoapHva9cknowledgd8Pbpctr8ivservhIIZ|;draggHin1nxhpow!lcHBeff01Aar¼3purȐ,l8ho8flpѹ2뤸@`($ګYnסzdiv0nitu

RDerPrecsirimpress ؘh(Ju19)XokaqAvon bjecdemo`su:sQit啰0woardgenough.X gon eooyhorulPia0asi-qDubli!itself3thIXauri0ٟse omyledemِxgniAfȈФcXveyo ۈץ)commb woul2ha(t <2B`Hicultiej[pg 216]a/>y"rmous.ϡMr.ladn`rottlp#Granve (Aug. 6):ifIVaHa y=so. 3Nos. 12М9u UTAK1Ȇd%_beAug8ǪcaYguRThomLadyrpePcSunbeamAsGnh rNorwayweeks'ru ise,ereetshoXatorteorgeneptember 1.r.ladstoneadnxcellentourist;asullfnt0stHဘhaw;d,aay,rewomeleasufromdemonstrati@cXosityIdmix0attendedisencim opulwhXv8moved.ongpediwithuchlimbiscramblydelight,ꇐl nothbe8him.ϊ0se9urs,asc VrfoseemsdrvordommP;,ePphyXlogyiloso8cssficero'snn@upolge. Im ,bsdid; oug lh(urXnupadealth0zfac`weIheuickly.hIoddastllEneavillSbm saleotakir nollalsoppXntl(wasppJn_.Ԟwiyg downXў!!Kittlak)8farapiwrlo8usffectҟ ettun)topcipiȍ8taiɢaworchoiaf@benefityBboatmentremejol@driv8spilesscartobt intik˃half-шꮨooaA{Sun(m4, r݊5ouhШ™ 0luaiwalAXambȰm0e9c=ٯbYardishykanbre er䁂Anty-f2wdXpro relpӑ8xsta.oGB [pg 218]a/>dPhspؑIcusXbjbȤhaY`gZatanilڶmaxllpluckژrgor,no@!sh9selapdo$ac(ex0weHanxiesc*ۅɧpength.H!has@from1fbfarmeBȒfaRga (0vNorwegibowhȓYypldworse-hepd8.Ӯ© bqAa,1“axyoȕ꥜ok plaatranslʽM؛pLogic\. cloHhbserva1religbic0whq\c8@@ tauа(xmb"s*prayeΎad 8erhaanvoracusua 8q@beun*Ђً*mᚐreviewedal@Iin8amBewBunyan&Gengl`@߱ʔyubeReld0;omelH(#0peyaxPݟ(l괛abbozzosket\adidl./div?r7mbp:pagebk/>219h="4em;hr|_////҆kh1|BxX. 1885-(6CؿI.̢Ț0hippTG!E. ()׃2Զ3Our{9toxl8xgv.-Hs|Ӊ3I32?c ba6crui SunbeamMت*n Se`mber; avyac`FortorXproceAoasqucXbrꜨѬ gen .Ƶс캉HLordapX(.   3): Iaveeturnedoerrairmaxtremelyellneneralealth,ndithethroat;ifuexpectationfingIconsidanxiousbdoubtaqsnowndhema8rorel0an dticipated.setamreeak0haporptYH mqpoli(issueIustighnysPfɅalsurrenPisdom.[pg 220]a/p>%1ubj؟IrelX,(Lϓ hperplexmeXev|NorSeaBe)xsoregapcpeeaBsdɡfel(t`ssary ≰iHjosoh`apMr.a(@8py's,kb;hbaadmɞ0fKon.‘HUos(0#(afel٦new,!dicul,kt ust,eemsimp@٥erxu3isiblitxa(itOJp>AoٵxgunkboaQSunbeamgublice 17.ɲ@`lo`a@mphl):aqnuJTi`clypjudgm٣BѡЙS. pgw(lfovaguBHaYuricry@rybodUxdhfeuds.Goschhpraii/ӄxi(gjownlagC1fu0Лif0o.3AR <:reLordpexIrish onHstOthrowФ:وKgnmeanr9th0hinciplexecu:H,irh@ercomms!SThoIhapterH"Xo8xepd0hovPo4Teoh f`en;xvaildisp#makuxuHicЇmul!em)enjoyans$(vȘgheasoncookery;l`f"apso=ra9lisap0v90Xlastqa gʚ)sf<ПrHcary[pg 222]Ma/,g`@d(9mdiffic` #moxvaluhaeظ٭ٶ9alwaysHhibpagoo`ï;Xqheh?:)0rf`hyeaa72-colM,li@ reصȻi1X#,a8riendwq/divxPrYk GranvetqcXrny3elcdor.lad0ne'senviewufİ(xre ewXs^gnxma0t!㤪dra:nerQaccuӯ"whoxuaPޖhᖢBToWS0(Sem@ 9, 1885),lmɾiossipt0+ho0ug oxfermȧng:pkeӨfChalupҧzo2hstШo,򏰥0g鷸n.eAHag:ǚanyr (Oc5):yY1a1imX8pperP pinگRBZcab0N b`pgsohojfavѼyselfrmo)иؘ!}9hip,i3a{/osdWRbec⏩k龸waeɲhu鹘(t@և;knowqaAiakoYscmקѰpap"f id!Yo`'hm v5 servKݦcommєneceЄ*ugrnzmȂ ]JsoluHe th8hen*xdgol߼unifro nt,hatroundeingeommonrofessiXofimitedre0[pg 223]

Partyspectsorgrammenliberalense,ithnntire愱omthoseoclinedPoravel@yoxibutotimpirwn3pHallȄeople.on h`ugh`wasR`determ 2momPc its)wouldoPACgovern.fpaseaderseag(rmediateeasuresloc,X,regishePen!!fiPad npwork,)iyscedx,:seyears?!so,iheysuppa.roadtpho9,8l+rop`tisЗAquesۍrichzmem@ib,us@ϙLordrhevfrX1830ɀ@4aב eIrishhur(˙ _YXiecularses?p>Ashimself,(KsuH_p (jIanvill8󈸢9h),LMysQkbe,9saysfhplacyY youؗІ+purexcepDXtakYoffice;p( bR"Ho@; ICgoosy5nasult#kflthinkst.~Iz0Mr.ladst\ ytt8!˕U[٦xgls@ Q(view fatchcۤ cab0ӈtrucyunl073t:A.ԳȢinsabpchie8howA,maib .֭ dv2mÆȫIJ$dlopaPiXsitu3byrrta@0s«PChailwxr`ubtB;ʶ1efYcaHawarden( roзxteinac@Zpassy:a>;[pg 224]5a/ UTc࿜3],c8, 85fR؊!e(s8I`vhe0de؎a.ȓsRodalkp,Zon8™Qc8rn+becapeakomisrehe(I)ٽ)aunnexsaPdiѣiHeav)tpediuniaiʷenc1arguthgtOOnaDPeoj8iti裔ܾIa1ollows:N1. author@loPعrcompulsoex riB'#6300'#8'8'dasgQ:saiqsju0۾hold 9en·nqSҿw됪xlligi0x񳨗diЏȫHmeْ doctr#Α s0lRppl=LPnciYmild`(pi9HcXceivɹo wQojѽȵyk(n>2regpAad]tax2ػ Zermm(ddÅ* anyewoon>3f9educbFas8YyǍ adop!p-c@ )cae(b8ǹ` erɾrighɳPidu3oQiIrg䎳wchooadv!d]@JuYi(alȧŬ{Xrxwhdecla8gyD <7>Єoutejudice?n>)ynding olution; cjhardpcarrypisoiwrankf< Cu0n8.eid,TAisHe)уntXbP"liberalajority (9umiexist)1declarespin,Ighn[pg 225]}a/givffec2אЉlookPa gka,>sustadPpport2easure;肓llowi[wesoarvidasshanimront,PcaHes8es@l3HȅI prAvotЂupursued.ilepos=0001356463 id="Hf_139"X.aHp0pThN딨LordsRxhpishjegs @llyr9mQ!tanceރA`subjsɖt衸phpmbgfɀ؏8, "YId+9I qtwePagreed;Hlp0econda@xlyA Parn;hssficquiescȂqCIyovern b(,ooCw,РyaJmatxs ¦AgenZitudא5874040W,0`nk,saolongB]9١p#Ir8 ؋eax (grac1ୀworKscofز3politic ik\1PȣundXhdѴc bgqiXreگAccommod:WOUrChamxlpreduc*b!umaqnesQm8lefttouchǞ¼,ppas(w`glyIreado(Le8rurears'gn>HawOct. 8, 1885FIPs7wAv,//biha]$nyТwp诐)ߪׇнC2outlhadn8pe @sjy84h-g. @d8مYiad10noermpp8`puHe wCɅ`pȮ?7n>pohi/?ilifbHXsX np1pr+Xouo[BXxfome.ԿagȉrZɅIorm40m騀ossiisl:͖[pg 226]/ 㩠(witbeginZnP@QperhapXXø@bcircumymigh`blIservi{-exaciP97111nmiodemJQkiL&Ra gllawoʼfӻ' ,;IL emno

Iui,ahowatuhtИZjunc sHKXwhosboquAb 98pe.אspec:菒mڍ uȒJdescr(arisIm1dyZ0ay aiso愀myСCc «a `yfqu Y`aHLet8p⋒n>Arsc2mؙP\iѯ sketchiTQyѡac!9;oon`sBhshIcipaea*an`ds0(dowPhipdi*dopɶetw9Ssxdvxmo`gVP0u8occupyXཀyP (ccطٺ8y yA,H Gۿi.סӅhip],yEZ0cXmajPirack;ʖJm Ybu(voluxrioϨinceZhy?grjectᲈhem.ϒ抁kn"s`ɞsp@̜13happaysemitq>isؘ繡dem(ed?Pznty-five,ile@=0001357172 id=" pf_143"܀Xa|afifthA'>noiculpPlific5ʚZ9neshtr(TCHoѾCHlikelihood͔, ur, HAtsm80aboħk0kbol)o@ljIف*Xj٩0isgiv 8rehens(sjeal؝Ȫ!caIח׎0ߗߴboఐ(;1yxdoexill''n>IrmPs?ύ*ae[,Ucircumcpsup!Ixصиeav𷐢YBiFur9bP/_>L`ber0takothreolᗐogn n!echdoZpugha 3X7g)o ughts.<2un>Lordalmerstonn 1859idotpeakhus.uteasoundo lanfnyind;PdMseventy-four,| i.e nififthearN/p/div?kh34IIIt `highimeiturnB0o(recidingXsuecase.ho0tubboagainstesumɂaburde"leadPhip ely!composescxetweChatswor0Birham,r.ladr؂zbf|Irishuestion,if0lXakeavHablh.s wu rHokeave0openApPhapter,ow1spoHart8QertHechParnell'`nembad ed`xhbfriendunxsu`amˍRpeopdayZbhp.ٮhyixHٸH!xur'#HȂ٦jdid.yplaanddrawp-roobC0arvYrinHglfirs`µH{sel|0nowHxclusiGA;Ʌۿ(oughJ{9 QKrrivLagriб @dowsow`re˥´s2ne`hx(w {XỳtwounExHwɹai\ڱ򀘹wnjauPnld.׾afxwarkeϕ8800ϕ55>if/+g)m)ě3Yo8narrxatutorygislprxfutrol 1axchcchaho`xiOngziZǧɻ@G9Jis:proceedd劝sPtainmAewspg(?a+iȶY.¼IȀ›ѭ*D 230𴺟br۟pȎmiٲH uatPhsy(0ne.xCaquiaYwhimadp(uiupcPrPQbodyʧ|fy,JX3{xkXawrohdire8wou ldotecceptedyreland;hat(eentralegislativeodyhou( arliamXnP 0afact.ordarnarvonssurP\isas Aowniewlso,ZPstronglyppreciaimportancefivingueeigh8oRsPi"0IrishmatterbHead؂suggestionscXend,akY:oloni@modelbasis,hichuck(beresulmu0tknowledg ubje|Aonclus؆versHonlasforrn r;?:xye`rgertributoIftm,lieIcompletzYwithgardEmoutlineHfsettlexferra@p.

Is]虩Jo:X{Mr.ЗellZalwayHnfalliblieflosescrutinisdieHcy#Pwo0oriؙXoPles*er9ommosupPed.Ԙ{pajustu72ne` Pany publicXXreadicQ.עsomex!i"ntdeniÜstSo it*I!go@n,9`ysussfu8#pollH@8a𠸡Gehlimipo cindepȣcbolUimfvi@ynHad*ɮHψĠyp`I@i0jeow لfspee0wfirtookAice?ԥڱab)coganCs`rocee)9rimyȕak@omarkPpzϴ)P@ȑwaeagЇwhoprXP ci"8f!sym0ormHbSa@bu൨qeehg [pg 231]/Pp Q#A҉OIPrThcaPbarp@ 0bi)nsɷp4sequ1Ѽaepisodivoqexhu]JeasXoЫWPIQif asklo9ward([ bպ)icѧmX6un(rfeelǯĻright?ôo+Xtalk/!hи(Ydow)aguws{-*luڕ[ Qung?hyHbhwiayJu)HurnGladst({cjkppromݬ``H⩨sXdbe˚lobbynuv:lexpoy oulicPdopկs0Htۗ2Oircum٩wthroug(t#`diteh`?MIn 1882nB@8RePHH5,gصڨdadvosixбhuncitub(2adXipurhlyyXxuitach1m entorartyhatumberednli-fivees.ut`essuQincreasefistrength xAcominglectionadll*diffnce.henemi-officialounds [pg 232]akfromoPhn eiPqu(epf1f!aGladstgovernm,tas((Mr.arnenoongc0tena0drovisHremAiPrviewi LordÂarvon,mercuryorapidYotoptubLarposadxi(arnotnough.ԌlaimlegislX"us8owertol'1nt.nnmPakableXIrishPratdemand, (shboxȂ8msolui.ȅwconvikqg teorkmselfriends"n@liaulpe4irwoDhhichqyaїvaiaskmpery_\`m.X/a p> IIIpolitnsupJisaou(cXmfolldV'stempcepquh1886y clstudenjf5j5Q*qesawpHamarkciPawaiout`Bev𥨟IsowQsenspregtXe0kccspifogrammep*ival8r#wngȜ)popuȍZn m Br2o12a9ofa0de3churHda1, `s9כЛȮAs.p>FH"jXa`Hsupar1pdebXW0excepg pe؎annawilnesssihsavouHse0dyrePcurP)Iautumpӻ񻃿h:seAldy,ns ؼ0tXl8idiеb9;cgcy-vBA c mXm`Qdpla sapr2i(Asjdesbe*goodis[pg 233]=a/<1ߪ-ؿZHartШChambern߭㭛p>QbeliкaQeeron2siYPa`𶀆Hinflexi"ZkAugY24ɼQrȼygaletMu89@1 pifgaqeffsubse`HBпSalisbuptwonthش賐TI  haPrePl8(,㍟horaȡJampaigrhityJwpزhsalbv`agonгXAlbxffP\de(dwhi3(ԱZɁOquickTғjngJ`o0oH?$ltwBXaHdef:99m0 po`Irelϸ(parlia1;ould)鮃Mssrcҫbxout(XrVbjо hi:+xxm;tAkbwhe*enc`rdiscipl(eirad ۝ghimyfIۼh(lqemp(icK>ia|,cau ieOKҹ:gen0rYi acaHr ؈Pgoзnonqhir(8.ȮdaokergeAX+procTXpaciЁ]t[Apds,ɏlieve, (ico8ss`]؃3[pg 234]#igh ottʑtuy`susin.soiscitable`nwIonpby`ȂptuhmeanwrȂTsecarAhonor)Maj(y؅xinXs?Ƀaystem completc؎isbpaucQcYYRupa4soxroprevail Ven!Austrianule81ishmcan mB pliftfingochiamuipYedu[work,outaПR,)erfptrolby nghhoɁore˃݌he IPreu8rityay:Ajre`ltquair anach`ismtk@sublhCastT9ȩyh!liabwill0P9.֍0lepos=0001359317 id="f_150">X/a>rcisspeemHpr1cir𡨮9*ӯ*ravpiQdeb.‘wh8ieprBmi9p@ov! nok,M\drback.Ise,sai諔ermYDsuoIobta I링3ctvH Chal8pe.9611p> necf膨cisku lpbePr LiAilHamiҮg w0hruoys:btakupmmشa𿘿@canceylalaswh=z0PؚdirecQ9P#ror8mHvag!ZyPdoub.ӬqsC?o0go(ld8rPlombi謨Bi(rlXvtBz.@I.woulharhpucidnoulms@o0unarK!Q`YeH)H,rinwhAsrtdm8dд@XPLincolnFcauҹHadvdBIBabQrocla袋freesbexd8Q8uf 1885Ж8aownr"Y8Xo0-ʮ荒@)aoccKo:hmple蒁ihHerwiIjp>Ine`i(a+capab!nrae8@ڂџ!Arega rdssheecondaryortfisdom,ndlastanohomneouldavookedorlungewroteMr.ladstseekipprovalroject@announcementastitutontefract,ichm(aPlerablyull-fledgsch!8eule.XniewacharitellegatiohGpicupOfpelPsdacitaowHIrishiXoutm`poffickeexo8,brep`|Childerseserveth`:

Aovenuxbu?[pg 236]a/dplhfbow-ro8XPomexcisȝˢKXbfxecessn>2.particu +oBУXlocislatuight9|Oexprkknowhmainaheirhn>3!thinkinoubtls[`ʆyak`Qpitsel8n(sp9educꎂqueo`diultZئԫesQdefensYis갉8qМ)aers8i9red''n>48sv0ȴ#eu1ȶcgo0geâdetailweinci .ª5daӭXf ୤leaLnҷaHɒطmn 08ihwrațp 8favindiդbegJ m6Ic&embir)rtar.v桘=0001359592 id="ref_153"̀Xa>Pw b fᵁAMidlhi0addaundoub8ൊntruRy夰ad1`excluhHulsi!hapfaca`runnsoree@QYm(,dвpIrisXuom)$eff:mزp cPPcxgim. xi#view׃ҭ3"ed iQyp9ses. ဈndhoanmagineartyeader'slectionddresshathouldaveunus?fr.arnelleturnsithgremajoriPofembers,ᄐifeinisoteighenough_XdemsonstituallyramedςȄitesrenanimounHHtryomle.jthhpossibiaypoticalxperimenttoezlicBwhich gonIattlgai(ordalisbury,I,oarsɍsee, ursingidea)st.

Sweeksaterhpeakro orsMidlhian,Gladstoȅziinifieerishxspushi@veforefront,ecbunear;1X@h@gravque8raisb@assurmk wzprobabthrowshhIra!dh0scr0ipeY.ȍ@labor8 clah,{muwQd y퉀hxyؖfpds.םIrnPimayДteqx ,0lzfr`eincipn``J)hoprte`c0unmpirp♨aboutHytآcfulXTo xpow01ahiÍ)anageʥpX8ʝ +error;0ɇڇ5Ys 즰t!tthed0cqemHaphl: A騨oѤermg8X!@@Is! eav9impupXyoud3.ɍ!hda@nK@е0j嚑"s[pg 238]a/>self-gonlw}limtoppip+voteaile@=0001359672 ="Hf_154">sXa>ulosusSbere`ʧr0ePxno(hpIdictum.'"himaipdsNiѶ#kqɿ$q~'T safǘ(viewropan2firE!XsecX`seȳ𰒥80dihBaNmajҤ=di;adv_걊HqaldPea)el(o SsP@somea8аЧ0ortapoyZmadp iitذfacilhanw{.ƿHcsPeelSp(h!corXawLordohtCfaؾsidDDZ8iesáЕGV;i)MaynooHActF84GD6G6G`p>

ȾEnglYabI*aMMidlxiӏmBqi(oɝawxy`Cdoubg'#0iXRexhڷ@jyӸtA newt;bhope3)p>C8ownlO¤G'Ma0TM;<1ysywȨxys Yr4aOMmpXlÕcavodNpitu KParnecQa0pbetwaHxt.recix`t'sɾ*m๱s3wa barklpa R ဈosebery,nderhooftalmenyeastayingttime:

[pg 239]Toord҃.e25DPark, 13thov. 1885YouavealledytentionoJrecpeech Mr.nell,niȇ0expresses desir@hXIhouldramelanoriv`Ired,itht hjudic`omperialPit0ndtets,managet)hxownffairs.Ԍ8subjectporta!)oughoge@r,willpaHIviewythxproposal.ƆzoZIssuBsucbed.ɒeifphadonsixxhopel( beenuilgrerashn1akit0tency3kep@n3YcftYqasȎ0I8emweighagainГducch@,serclon=5wclusIț9abevX<n>1h"noo(+Ber eadarhop@iop IublicHtais!Lcl77n>2i׋maktablnowQpow0[RДodoCpiplByrtb`equatڛ)ycom1HouYfommtQ;ruB-mHuren>3unfriendly0lastwixnalixeon8iglin2IpsyfЏ릈Ȧɱ!m9Bignorai`d!hystem(ayfinitsel8o per@derGGn>4ޏbas1Ymie ylmyJ 0ߧuntry;8 Mr.arnex1phenZ߹M.Lords|ideas8ttpme̿y@RomegطXrHmid{ҿHituZaذ`nɆɈ%8Qresphy.4caaybodoicPo1޺H75tworpïZfavourCwem?өnt):ma"B;ӞfualagI裴irquiöxsywJul@ixhxij,.߿q8h8i)ɝBPltogh،kYeanr`0bX??n>Qb轰lgrR2geX iOgrav,9solemXBdemamvHɿӿ8 1u!cx.קq:a8HQyyɷ!Iknow,romthsindicdpaKes쏈ewj@ymilaun ai no.emmntum

Threeayseforeisetter,r.ladstoneadepliedfromordartingH:+%ishAssomePamodernadiXisPB؉ustclu0iАramptmbiu*woȂpinuses8wardnessveen: 1.oryD [pg 241]a/|democracy. 2ȖHg8udisintexGeiberarihOnteubjs9strong. konduct=DukBed0(ВИen unjifiablsAfooh,ci`fwisH"銠Axel[bu@!Tfrance_n>Norn0dquȓσʘȔCchurc0,bX𠰓M˓p#decHlhonour,ʣSihnowӝfarIeu0r8_n>SIr1nesythyȑyou`XɐouchpoehЗPKnot[samPYou*,,rthHiؔfarnellxibu@鯐efuvoiddgġlaxnight impfdim±ўn8whiHIu)vital;0iYunLempixngegrosjwoy,n>i.nZlJ(newPpٛꋴ makVhprincip`walco!sx( ognibyordalisbuH:‡ &bodaf policcmeb'lf-gnmAish; noHEspeechЁruefPer- r8-vaneintopitei$.

DecXJsƈqclHon@3@a92know`rab0~Tdm9imagX.o`nr0imekfl , A0hon(0lofnuous.p>T#@rIep.markMr.arnellX䛠 twaТhaȺແɡ!\Ahro-HungarP.g2s0 ضPfe í flo(Ȕ|. ߣۢ}amHuuiȲQp+ggcgB slqBqѲSsh@Id$b`solu%idifficulYVrox1rȽ譠ʟmosp1ف*s0Ѣ-Iklȍru堈ɓhZ:b؁by- -bNoydNIahow,'snguagesoca(`gq(hdks)ciencrankYaskHhXrenewCr ct. `ٙansw8:lڱwdoo8follo[ensO`ancyercx@bڕsɵйsQfp9aabX๘Wim0ane tflia!rOIW2vo saQs Irmi zlawnQr|avai|checkud;av@Yahio8cboycotiiZAȼffۭlegisös (yeʡ igainyahe0w UAiaf @,okQ'!popula1Zfamixgos I0(ڰ cYget9alku)(Hndipeo9leavchurch?l؍ؾj߶}YlikPrcommun@STmiddQP$8kn[pg 244]wԿ1truЋ'pdependphumVqɲ֬mporIremembb!nimmedi chҾqshaoic1Yxelؙas!ݭviolASt ingpeechesveradenreland.XԂemustaveeennownoheisho nment, irccurrenceurportfmpresumably75hYoreprimeinis0.ȆXasdeedemovalxciuoysbeaconsadi9guid EnglnavigationӇQwas.̋nessaolidltimatum New,Zthout@MidlothiwhicPх:p+loafwardsousoulpvague,lselusive.omastut'Xcolleiscdelight(ws$seepp adyetoryartyyxgPhopJmAcf(--twPylib@l0h2Й.

p;sWAGreBritashoulїrseems Pdecuntil;͕0Gladstone؝.tš(@`disettled.nov. 21manifoSssueؒhdIgora`ΉAtacticobviouParnellXinybrtwo؅#IIinearɏkolpl-conBoXaYZtPgupweakЏ vfrom,ryT0rexoffic{hZgeberms6007788cu!ȭmHouxn.u3phrasX呇*e`邠rtax91itVenough>rXo)pasp$) o谄l;c@isrss, p! Whe=(ʩٴP@᷋(at`diffQhivisLGbilewnths쮁[pg 245]a/Ȣ1KMUIOectoraca!easeennfficeorearlyiftofheighysince.neptemberneumostuthoritativei alxpertsidotePow*8ieseramoihan 210ut670ats,cluding5yontentromreland.wonthsatdmittedtgccimprov`,ainPowohelixersgpcalleurchcar@FaiHrade,(o,ddPanjvPL`ashiOny dpollsstim0 x headquarX aHjIXfI}ishm`combined.

#II/X AshouldStoPar qipagMr.ladstq1pceedisx1ntuencnΉ"9reviousSrfound, usual,ndlesr `xoccupypm,uipSiticsRsؙraQnt9.Workesay,` bookJr0Rreduc@my"roomappуer,✨mupdetailхildA-ygxsadisBBharraycCQl\dirt,TؐaltBabixwixme0Pf(aʝmiscel8e:adame'ArblBoy'sR;aHuAnecdote/Cuvp&hq,EhWhewxAtstronomyќLifBilpiHennInr'SchmidSoci@EffzChtXvMiM8pauutobiographGAnsfGlible,BowowardTrspn2Tn*-d.esAx=aginna趨HermeHit,iwhɼеhщcrep``M.vi,pؼDa` ZxphYorr̵of -wHten tQP(ya"marve yriihoo佀؈8h"s.ͣyPr Ct`@ci0luncn;olktI;Derby-BedP`2@.Y@gsL DeapxEOcx7jQChalp˫OonG8GGAmfgվp>Bex=Qdoctx9orex`df vocdLwLst(HDalmeрceDexploi1880XcZaspienjoynimajPneyvastQhusmwhi0E@burghgњeHspee s虸1by iminish1xga `dicncySouda8XfМItHgopoint@imrжcneI ʸQ྘tes<rfoˢʘopHite;z)3vi@[pg 248]a/>`߂݊btimya佘mlqAastriumpHih*woulva|Afgput鼛(`Xbe(0udi(ad@t#valPtbout`Africa@ansvaRid,(pax@furRdHc thr߃ۚtxCW3kenacZur(d dalouɏpciiopASsJnXHv0subjunmeasuQdenH`, hiнci c!iȜ;ؼnllؾYlejudg)(usؾH𩸽liزcԅar!t[es)`nqu0i ficaр .
isirstpeechasnreland, (mHgureseaveeen,argelyremphaticaltohest.isestablishmentjhthornipic,orscaref*churinangerbworkingonsiderocIEng?everydScottH s0b0ranslatedYelsewhere.n:daywhiPihPit,rЄ@is: <*Muruminoxmadeote` arIuldHnag`Xfpodinburght 2.30.ackq6.pokv0y uAFreeirkȎ:ifficulubjec@TpresagitoXstrengnamincip_Xleagex+a掘uriteaalutamaximH,hxit(serious pYbiliؕaXpoxu 08utiroptimHer,@mmargderta@complI,Pr8enouonliaBttle*w"0anrroxtthruhoseǟHXo㞸mTshdarknesȗ\΋H)IillunvPx0imponc@b끝urdenmatyLmoSX/a p>

Nov. 27+oҒn; 11,241por12,924, 87 cA,cvCC`7879ʬPMr.ladst3248Dalryajo4631o x!sP0Zc[pg 249]/FDayssbѼncsbaqu@.XNidlow tro8ᣠady.quiظyshZamaz#sXbper,pgna0hiff(! cywsofn ruр dgingourriveilesooliticaleetP,istenwithoutsk#rglassfeer)speeches,xllowpointpon-Z,ndhenrubackgainumbly 0@ud.ЅCiansift:rhetoricgaoalk gryrevoltpeasant8Ydeclareattamostmarkablex mationinc onversFks.urnЈ8rose,is`liberalsadxdeirea 0geuPivhherePeroryupcyneqisputeWАnor.ham8l1Abrok)arty0zborough(QarJtogˍ*natiglabʋXWsquiafarmerxsav@countieYYomine؂ ucerriagXNorthpndaPem€|BatIZradMWatynnxw!all ؊&hoؔWxflueYfeМ`bro@nxAndeЋreIwhicam0spicuousn 2GladstoneYJu8ascripagИgHerHAoldm, O!@f sps Ȟjoy(ffecAunhapplau2whi8ynQrece(p ea0`men.ΗrPyʛPotrola(hHmm8peoplh-day.ɡJrs1kP`

A@!pXb}`romPbeyaPd ϧ|* Y1874 _ownew9lixji82,A8i)r88dyy hvel,80n,B0񰸥00,333233.[Xna>¶#[pg 251]]a/|divGenesultJres `ckyѢafz(h.̻ȭ ampt qة2MatlyQ(saoɹflic0ill-chos8SJucpxdoub8Qམwisd poccep;kannhcackXled$4whol윧\sмt,e vw`h(jperhapatiHxugre0iHԎbo anZsp0o0acidwlatmmqcwk!8avcaQ`h3+IV?XHIrelۙ= ҽPt gУOebaQphec镎enunPncЍauldߵ2/>favour`rlast;Ken{2epservxv@easantHvic selhLnonaBJowns@beyoQvbMŹlakPyd蹙ox!.Ply $؝XC8ab`ahPr#rch`⿳}rEv[my@ssqshrewmtubsupmxv:makinр gnmpression theonstituencies.ԀeffectfirngenuousperatsasournishucheasurenJalisttrength, wouldrwiseaveeemedXcrediblelmo؃ AwthemselvAancrwoillffice.ɇHdiviɆ(fork,toroll300otagaearly 10,0fwrfayo2one&Kilkenny1w)4!tgb17ypnЌrJ2202aerrOHhavXP_[3aundIbpros0qcountwith ident셰lord(aoodlasڕXtȔsÍowJdare,qca!popularҖ48 750N[3169.467Bsomeiftyǚƒ?8majra،`numbersrom 65p!highesto 2 ʆ.ˆ`wa1tstilHtho(zsiwhiXnoPeve8ttempted.

Ulstamarkathppenpiavodv@ɊtXiam!retȠnilialLartt0ndaanquet0lf(Nov. 5)u(beel0hunlucky9affafrshazzar.Ȇmi[Ycombyώthkreek Х0hP`wtЗzDeabody owomai8hLndidaIfedowsePX.trcolicsIc0damK!WXJTo:P@,3>KExtraHinaXResul豀Ire)xtruparadox0(o!Dϲì8цj)mL.Hxhhy2a#hX0backsliHghbrlp,,mofuri)PcЫflagr xrXQBLylacx.ean(@?mmadeI(y}sou,phhҷHuchr(nerg5ܾptYXticpxc@e!adĔkbisvYxkMgЩgiyigtheac.Ƒ a,0ɿPinvariHUsᑁtAxi@lsгcx0ճrty-黱\+HhruiWrb8onk35Nha9F칰Ӹ߸sٹЉftxbya8bag@g.]neigh骧1sto;OWy-҈ܳ:,͹Pall'0XnoP)+fPC@¹Kʆsuc0w@mmajȢves@beྼhiCq}ers1eлpmp-PumpHty0bypPXprindJec1881`QcpurكقgmAAhalf-h!doubSfa@lesdissheyemembPdllhe k[pg 254]a/>alkboutr.arneandisollowerseingfulfnrpoliticalartyဨll,Irestit.khawrevelationhol'sQadisezbeen.

Assuplectordemonstr,"Irish s1885`ver҂hrpassiyountryshineirdimeaespssiƇymadXvfleetsXHanmhtenaciousentiJIrnd, TprganisodiɏdirxAk̏Ac32noWn+twooer`nineSer0liajQdq@f(fyears.o abl^si@ setealiIiepisoask͖PwaИXend.heyou`seahvxs㕸ultQlSbIoA0bHhvehpr I\threedomxgai؝wholeymegoXnnuٗъɋ12uQnewundJs>EndeavouHp!HcHso@l:unwelc.ɇ l caully e؊erdihm ackjuuch$nu9)Yheclmselvpilehe,aHphᑘhprdXrribhimiorhХmigh0yd. 2matfa(Z@pag…?ansydlo`yǬa` y-:sreturnx!D"rr0.nI8pȩc<#gen`l^PBelfaaal'CDer w[Ъ-ufluencxړgerpQnlikxluckpec`sew葘rausuchorHdolo0xxp@eg(801跱;`qt{tooزYloyafpxPѼ`il4s;hoppmbeliWbP(Iɞ`set̖__r8rompۃdg!yAhQy,amiricortife"[pg 255]|CMr.arnD`U/ 1aly)know(HZonclustopicuN,hȤ,pishopKclergyJyCif`g̘xvashH`idmengЦexIflock彉l.yr [pg 256]


mbp:pbkxh2>SChapIII.Òí8h (Decemb1885)T!p.pas by"Gladst!(HawȤhsYdepmediasyru৙nj`uro,Yڥ w鬸, mul ɏrtavid1Ir!cas0zw hqȒp8́gcang(policnoudactҊX:ubscabinetfromPBpoJvi0nowBbussbsurvHraoscenkZunravX;X6dlngCrfuleniXPitP `x Strip)nioinnuendow *Lhӳb躨fXweekXrʶ;0yruС oxmۊ`nGichien.|Up),Ĵopr,wЙtookficH9revil,ʺxy骸ݻbeȿsBrouginfl`ܔnd(IoRwhdefPsy8m"sdeC*AihrHgit.׻Ix iƄ'm0@xQo8( (ə,h somepȿh placg257g`Put8deoyYBLA1870(BPp2ށ81la{RemiHc4#ryӎ~Ied;"YAbQhiduY rivaʺexY_T_oev ket胃`tР@H EfPlaw©0 mtedyocgesPduȠќadmir"S/ti}suidohumoumhnځbarP9 WC ƵkroritKʻ<ileP=0001361711 id="f_166">ˀX/a>8P3biograpp ori k#H8.мicul0irmboQi@coerc.

_Yhpubexؒ!kȥдуr!leqعó*"1n0s"@`hona@cphmchmayCeїLtaXloaȭ"x.980Sf'} guagsurZsixnth@wa`quФreaesoۈynecimplextume thods.hyhouldotolutionfheresentifficultiese@ughtn2sameo-operaparq,@atadensdvantageouhst9ndispensableorriticalccasscury?eeledleadingcednXsiTeirepeATestc*1828;alicmancip[9;cornaw46#ext(/rxhis1867.Ɋˀtorytmemortsaci Mr.ladxnerceivptoremelyoubtfulhe an/easu, rriȉ+ybygovernm ,IhavecoexceptndheHiao `ichr for [pg 258]aXm(Railib@lotBIH`Commanduh yossePyڇolLor;5situ*?in(eriyur1xigxwoP)fifty-.ysrleʛۊqaWadwiTIhuQwafe,uha(ہ*uJat(d[danger;ڢrhpporByalisba荁x!)mipryxtaken.X/a p> Z1.skru2pSPiЍ0љyears; @XcПsixnth0lo durђG hn, owps cabineڱ tinuhuPRurview. 4n*IreXȡcRducday.Ѕs*ldownerȧyetaجhteúSpublicecldȅAZu p/1hؿ9sissXWQ0sih . 5{mPePha2IkQi ZaSegb,dotvseowϲso8cpHt8Ul0who23).Ƹalcc؜u,ProffOfӻ

BttiX)afterwards72wwonxoayres8ssp1facadpenJsugg%conveyprofft.orstancritesrH0 (Dec. 20): Td`IZarsa: Balfour9Eap,chmitdmyublicmentInk,wially`h B ,1mat oriouhRstsXcom˛GXalnʖa.vthims(!ospeakXKs)3canXkaHpos ipur1de`('#sgoPn)!sh8ƒ!pervspih鍓T:Afg`ihk@Penula.&Newiup1NmP`btiyliItwejrihُՇlec,ooubtrrH@CassumprmightuЊM aewoyJb陁g[HYeanuvre.eimalwaytta ps/aâlainEnghxsI%,)lehcRHorgo tptzeR sys!yeaap su wpiercxigencYڰ2ic0siblyPrx`񀱙9h赉o@nъć/48rdrawn@rgujircum grou(auom hoied{ap favpnd(d!prmedithg+P 3iliuemHaR"XpRdoȻstubb;¿Ьb@n(ٗAunmelaOI(cоrI8(dJrexpHcaogoIr`#gPriqepdveȋxeHIٮ1A)ss unico2PpAP𺀺8n#turom?ϊ/hesE8=lR[re[pg 261]

Ljstawanw@{sypaubemmitt#psopreiou80rxse.h3+IIokXaEDecemKGvixtwHiscu؀cruciЕXx`y3UagreKgi!VwUlbest㲘! lxPs.ƪ1rd enordranvilleentohatsworth,hereeoundSpencernisayvisitr.ladstone;utothingmpa passedmotthreeeadersusroughger qroof Hartx.HυaU8asullaIreliQeirectiXsomargeosself-governm.ԊHhostscu*ɂatelyithomuchxpropin.roceedHawarden,GAAeoinbyRoseberyirhiefepemproposlrXytB(p. 258).ϊrotĔ(Dec. 9):

Youave,ɉzk,cyut turn.tould"eviolc. 8r ؐ avabxc*beHon`sa3̈́*alsoSsfxoYWII *althX,lowerBmanyindsork{aʌnalduc0hcaseAbetwe` sep0a.žH-b0`r@coȇҚH'.th8seweikhim).ȤHunrivaPdri9ishdistr,powfirmc0difficultircumh즀Pghublicpirit,prnfit`ihad1mpxitup,釘Pmorau` ancڦiuniqupHenew5S1@ Xuo`syst@<.ӤaզPinflexibruExtre A(ex1froP:adic0cabSlaxm[[pg 262]=a/>Eelev(A9velookk`kXOj)inҰӯä8;ϴy lawperipsY[ropYxfl(qP Poyi([JsucaotėnÌpmHita(pCHȸrrH2oxwerooeH̎pqr0v^ow0*HpiAut]nor aff-8wQaftv@jb si[t`xng⭙ Lr(sulltruHd8տ(0Yd.nϫѢx09hgenl*`gP0ouo9inciplbe@; a ma!!e`1BhyhП(knowxm ,+rkxAXQ)dir bod@ai,oal؜ˣirou2Qumb.Ŗe,epl0,U/Ӯ.TihICsler'se.

Pidd#H!ngحworؾoewSint+޹dlo)-umɮ)iiX1nva`letФRsoᶱ©bevmifAR.Dya1caimaitc4к趛p(Dec. 17):;divjT'܏pSDhotm:{exc"w=rmXI pd*Iagramhich@hadefgabexsuطPallmofXlf-cealᐳ٘j*bQ2piɔ|dP,%S[pg 263]Ea/dٵPnegotiébHʾ⃂o nsheres,ɀ`ink,ittleathaveotoHoressonveyednubliceclarations;rincipXg. willryoa8hemefyousiderreland@s8wpoken; anftughtbeade bovernmentT

2.rotecoinoritya fficulattwhitalkmQypencer, (taointhowe, in`3.Ə oc9chargeson>4. uZbseemmenrevivGtan'sbНi@Hhear;*uph Asorud ewho subjon>5.e0Ppinstrus+onlpulgiesPdȜec(dme/n>6 "@`Qamxpщ3tȃP1!e@coߣIouldVourxi)ldabؑ,nc誐s@@w2ena!nJ0st"eP8rbidds)weuI)mrumxzxuez,BXneca o0new 19ituസSsirouH,hI®fieǯ `i imak'ڬ(fcolXghaة`mmuniJnvP@Rosebery.׏pHpiXo?77>TfӼxغpm gh#bkfd qPA9du1!pitgxsel81elsZ!th8jswe0Ieequhcpu8nbignzH.rN8*,ȾwC+,$a y`s`, k[pg 264]Ua/4a"bڲ0 telegraAr knPwhejҘp(Y.>WregU0ʛTѿE ParnѺePri#e IupHMxaiȭi.y Ўhtț9@+YbodyYpim.յUPiun`(HxJsurpI `loan.ԉoȺpnegoticarri 1yd@nog;speak|lPMeanP0keepfrefu_^o.ЗpX4seeam@urRrememиY ˶ syЯba/div?kh3\IIIt`o0깈顪fliaurzaicuЯgivȶPde0l;hes0hurHv hwt*en m0ȌYfurisu鶹Ъhx̲XXwan8؄Hxtrainap题9QfˇꨠHert/iLond(. 14)9he quencefpeechadepfewayseforeyir.ilke,ndthelubalkhithadetoing.tas`kenoea@hat 8Mr.hamberlain,twoadicalersoughtsuЂXIrisholicy HmiboncoctedtweQGladstonParnellouldeceiveoenersupportromli`partyiX*msafer[pg 265]

ResƃHawardenHЉoriesnwer,Qexpectatio$som`oateasurȐr)mgom lycɀ(mitwit+zmen.acticbthisih0quivalePÓs?8, `Ievery`xwropronouȍY4 XsZur`t.ZHerPtOnb!longLond(\imp؅*astgpphi3[absOguidp075˓/drifttosli`Unӄכas[chiefnaxᘀcxwho"pviousld!ӅOa蝉eahlemax(qnviТ8 `@gXPpapsotmУit1ow pin8\ssum@Ǔ/,!p mn negZ(1Hfndyri(sfُЗ`rapsluckiТsee舐e訨sK8iuaismarck(o ci1cYde؟offiinspirarac journalicipodұ(wًʎ oyallY6soHswedYular挰XwdoY0iosi@n꣚ai Ñprx (Dec. 15),uslanguwmtookjuXfy#r0ynXnȵga:bouHworkʵ`)qrule.pWb(sa1s,TϦσrn0ltimmyXbX(n+m u l`ccurrxknȂ *eet.sdayE7)ъ8Hghs (a1re񴘹@bȫe$m;9adBub8hJnowpauthhtyHؼxdoubzطlyqsaio1(jeA adv@,HrǦJ8iPNx9to`hʹʑ{hful5gɖk[pg 266]80l`gybglFericG`ȿfailu JoseII.٫ٳ+eૈtepyou+irs0NLsc`Qyhcry8YminNʹ)1)mhhyQsi`Έoprub82vecsil).'sni0y(sibi(Ә)fȮ&pxpxhpdi;JaIudi6BwwX9{:Ӣ@IarlinPrpeop b˓rpFbfo0becRal,mZпfXcas`ve9ntrunٺة(amо8,ћل2YfllowedLordȉinghsaw lHaklyFky꿐els ȨignH0Hbon @ؠly  toheetterfr17thlreadyiven,ndointedifrankness whatouldollow.orubjecbeiscussHuntil meetingparliamenti߁߄#knowledge,rOpaf`@inr.ladstone'spinionbtimeconcorel)hadrrdgasracticable.neplyhimwp inviQpersonal`mmunt8sLordar8@ought#iqhaewaysvahimselfyi( (Decemb818) fearplittledvantageojspurg gu) romryiends,ioceedrchairmanLancashire 20),؊ыJpublicnoposalxfPpoyBIrisheHSbeenm;ҎYownxoۘ[pg 267]

NotesfonftaiAelH@.ԓ1)firstugHnyehY0twљGїsoshoy8becJwhig s`ts.kp>Toresisth2anyH#Ăeasily liketemС"ʝPv8ҞChaIlaXy*moУipi;‰speecfǡshowit.W@fa+A,dlae`r(rkonstr^peop!Theyv IHfar9regard;gtajoЮmatlyQfavoua!nةadHironsosysc ltrolds`xfs.ell,hur@v``1decpZ#)rinci ac~ju٥t2m.WimporptCmYǓÅ+judgNyhph%(Xrfesafe ޾sxqu1̸ٕPQlappeaHy:epLepimac@ áwXceZqgwillifJiƄi8e;Ɂ!roa؈B ȠciliҎIV Toordranville0ʁk=December 18, '856*...ԃxkncessantlyboutheatter,pea:freenotithinalityoouP`RosesSperon(coaguesaveeendtruste:writHarYt(whod"courtNorthbrookhim)orerbyn>Ifmade anyp(ä`࣐ajbetwns0cries.e讈ca81(xieKpr#&㦃samo!rzavoApmunics𪈏nt«brKsq/}OnX]ȻoMrlaonHawarden:k"ask#reqH1c!abine:lǻus3sstffai ld,iBȵapPp0oAYQaQk moȲe¸exYpBIɂثawC҃ظ!yꫠsul(@e{ualЫngu72nswerq2ddXmimiR18Thai9ppاs3Cn@ado ipoffi5his#cn`eGG;togeё,ٞ`)yX@ڭ̏ütaku@l~ *j`. )µnqyBI`hXJȶ,nuslehswTq;3onladB*, 0underisioblig*asAdicurregenlldgpibilpPo>TaghiY8Qpoceeb xwrwndefi؆h(vej XaeleZY8re؈y6ye sle`f!YT12xhoJӾ(kso橐nrregulPbuTbeg0 19th.¸iIshhmuxxAc迈9hoYw8hడJc;dpؒ
December 26, 1885.T؏pselfustrequo,yqsetp,uccinct,8finit@exhaHiv:itu MGladseÐimehgppit{ Secret Ha!CastlXCh.g1nmhwn>2.ΔRalispsup)P`cn>3i:x"rab1(1)amf(1nsnowy8sirylsoTly1nlfrom㠸retircumshcesωn>4fB(2)8ʚxa8p;Housfommons,R(jfiqaiQZcodu08a'n>5@wR`Iʄb/gOn>6.— Pftaupf3irBHuyQ8up, ny܉otdissol!iik)gϭn`y250fa420Ǎ335elecpoȊ+mn>7Ps`ourysܤQ ܄GGexcep2iwqcaplbYeoplu@limoYtrongJ!hДɏl.itnP354159,O[pg 271]a/Ķiemthreiخl暐a8輂Ӈbeupysihf!inadvP'n>8 XarIink> Qbetwħ;uot(9c`CNdtor(Ҝ0Q@umaboܲxa3IHsexx˚sibл2RlibermajP`sh kuhrta@pPoebusizhա` `gg`0dlooko1(end7eddp(prayajȇ2cho_ypDס״ҿ>11縗ΎwsvieǺlj2.8tp`bmadr`rhceebrawYȸIrish3im޶ȼ3pkthas>ad%XrJigh ¾ar9aed;ћcsepasu0Ӟ[Anim8iPdg,tilbeuhop!e0siunicǹg4.µp)likeliHdطi`logic;UobviatP,mX;ё0[@go]ݟyrXp8Apoint//53casudRoʕcied'ignQuѲón>M I8ar a0j𛮕RӬon`accerisYquغJenIxr_plؼduguard рedomeule?

17neventV,onr,c!theo|aionearty,hichaso re8innffy`fra0aldulyuardle,ZormPgovernmselfnvitbpQueeopo/Z[pg 272]a/>18.׋(Irishues`coursema0amount;uferringliberalX0o@padequatMmeasu@Paxrsimilar(lack,苸'itlkqbXenђigiv@tߔ/divThenceismorum LordsǀvillxSprreg `on4eirinItepswhsultalers.n ceivim'Yp`Joi`0proced)Mr.ladstIwro8him (Dm 30):=#TcwOn>InIy Ȏѝinasm2s H kep0subjecao_X,aermightxhib |AddressBmay1bett(llowڕH250yꗈ0670assu i أ)atinu[administrVimperiaffa(ȟѤ9valdangrD.le0ook Ȗ覰bsolu(nlty׮n>2htae܆ Xo8liPnta?/}ajorif`helPeacc@ Runi2dy㛸cipџ𳠨ablA1h`fȴǷn>3llabdicnmٷ"a@rpȱpostpiq(aphed)hsrup?hoxanteeagp8˃@icdldP衏ppxhadm`YBuɻ 21u;Timesa-affi0itWw޳jnowad le82YxdoQwittМscorٹermit࿰Hyytud@lxobjأfac)ate рtudyyoundthersIannotaytashollyained.utaveone phing,:shalltoonverthosepinionsn(ent,orՄaterialee.nowey <:3pol%8is tisfitaken0hmyet f17thHatshouldKX݅WxblocW(.ٌɇquiteelcomow,fk怑`#mmetHarcou(haPIlieve,exy1SIis),subnceTe noubIa rQsitupoXsp@uaittloP r9r.x(desi#oughۈYrendless{nexpemPsQaesfarign Anyart0rhsbulabY0solid;|Prxs//.hؙbekwrppropbvaixPinon t 4.m.pq8is eZp/div?Z[pg 274]-a/;h3VSignalsjiС2w餑APaH5AYխʖ H)me8yinju񺈺"ymeaihimseȹzs CrecuaHqI el 0 *k֒ul Whrpr蠈i@qcȼpHna rthÙ+$twonglẙ1molikeȾ@ob desil?n|rk0 hiȈR5o`Ҳ! firsL8abusrenoua(iaafX!servdoupurZRofficVucdnumJp(ؤIv:DfurjcommuԧyjCarvShexpp*[ade̵x {rϷQnewough: i\lbI[pg 275]div>Vifll

Be8DecembMr.arnellIidoera0qslightestossibilYnbeing@fd1Yconserv vesdxistcircumstances. WehɄ,zlBPsan)inW1PbrYBmeaY?fAye,=I!*.No:3IupureR@fwen*ahڸكs,ha8npmaPBes|0 jxu/.ufجP ro8ewibHuZsusiy)draw[/]϶gsihyq?Hb0acassoluu*x8spX mbp:pagebreakxh2fPize="+1">pIV.ƖaOfԿFirhSbupG. (Janua1886)

ResistancenoRI(hemandeingssumed,ariousacticsamendereview.heyightginyk9forotefonfide,ayAplainlyatfy [pg 278]erurn out Mr.ladstonepin, 0wouldroposeorule.ɇcaaajoriwasotholimsiblqwhig9cover,rituicert ohelp)g)nment. adebY@inopeevHdidhavty,Écb9itio2adviimiqdissoluu:/ő08or@urh!cabine𔱏)iracksp4PfeonsIPmer;srowZboarCCarnarvHpolicᔠcargopch؏ongrketabparehexperibaftrludicrpshorrial;:9ickPginstrh!erc,ĔYsixonths𚘝y(d0thelaboRosta⛘y፰dedisPuvkeprefu)gnuntilbeQPؗhapacctexhausptself+x[Zxpdsfall1minpalnNE@|lea8AsIeؓpoign0(eassxbibbIrXݢzYddhOctob0(1885)oxRlphhurchill 8vipoDubfimswzsai(extreme@anxzQalar ̎po0N:LeaguY(gs(zp/)fromEBirHghamyy, Nmy20ih@s"decr蠪Alaw`pnngab0pjxifiyRa\IjragˠBdi hcu¬#hH(rtuJɽis.ϸ1atnZl{m(DecL)hh[IaPiplop#unlXq ce&Azb,pj1cpinH,ҤCsubjecWؖs(.קQdeliا(wᾘleng8cIψrokdowRexcHmeakreYSqisHsabh [pg 279]sdiv>CgARum)arrainScrQҸ/Pew*ٹn,foll*SWixHaXDykeٯiefecret8.II/X

Qcu(@dHciftawxenmi𢙍)8plexes,low;itssuHchlsengageYse(d؝p dǞdeep@8.ȊrAoccasțwcrafit)on8endXty-sixPyeahsp sBrn8iewpAmfXre0rtiXreeڈnIsspchurchZc18of2AHuxley;arrЭolf e(,g9(ittle;*ork8({bookxangras;X@easfieldpHALe`rs<, S`hop!sPMalayNWحHaggwhicx;:brilk ustriе`8;pix؄op0rǺ`rnYd;K1SoloME;methATol`(DiceLxCptitonpAsemi-seigHmblmadashimsgbunobsorbd.b,n`yurke:Dec18RPk;agazfs񰕹IAmer(.Janu9Mpxtsr@ 0ltv׳!h0iPh@hePB۝8SgпfiH p"infldr!puraк exaltolbDukArgywrqs2|8cstudJ׏YԚerviduѶiHScoti̳ȼineBsuchaco؉OIrisltOfɿٌ(dt r[pg 281]~/>paa`hHs4Georgeiii;X3cxn.ɵҎхp)ahlelispry(ogy߿OM-HESdSbY`IЏdur¾Hth efXndɻٌ4C iM 6be0suZijnp(sy0Va `pamphletnάpҖhDawbCYfxnkRm4modreve@fldѿFiff!yYgPlif)Lprep.Yhaiw+ @,08padecl9s,owLIm8xw Ag*񙺛@.ɮn9uni0!lmrsag0erń`shou8bffgM@r h9l`hHuxleysi9c:PdHprrivalshreImmurabk@:ѿlu0hpYxӱvys@ighf  therishuestion,hichffersailyhasesoreressew.tas@yintensehankfulnX,ut,laXnotJrecollecndetachment.henillAtcome?ntieBytringogeXrсQmonplacgeneraliti ofrethЄhlunfelt?..mertainaineekepsitoexXcatedromRliffRahincids 82asQureaQinmeg؀yR.Ԉind,(shouldynmnce3I)look0hafter.utpknowruHzAwort(hsxbyth4Chtakfree Ienrownoodime,H!sؐZtomercidevised.

=kh3>IIIA!ȔoiravManybodywhav0ouI"erisolaquietudt際evxM Gladst'ash4me` coeek, ”pLond0January 11th;workoa9arlia٠oҟј t3sh;AY[himselfQ{[pg 282]a/>dghrlpooTmw9oHouPassemblԝpat"s!ceiv(un2mupurb0x[s1oght5prosp0alXityGAcrHLordranv`e:fiPryou`()m,sXdlxnɐa⿑YI0lix:Bpyթa@)wh!Ͻ[pg 283]a/dDjoissu40rn`call`(˰e!)oci`eff(u(r a { )ramourxТhxphoicununIцupK74dt;ntqo`oruinHavoi dt.

Thisetterisclosesithrecisionheriticaltatefacts evbeingaken.ssueasot(tlyoined[miniszhomeule;hoicfoundoxp `(bgovernment;Qbrougheeplong-(nd!@؇am؇jliber`leadA iRthatr.ladstoneadrenuouslabourhavoidromBbeginn1885end <h3>IVIagcomp)autumnS97,ssbYnxietywhiXwatchc㌸cee).Adds:+%I2Aea[9AiPowȘxlk0reli(!upporȃs1v,̙htu`lia"subj@Ղremacy_ pW fsangu0+Hh.vXpD m9rumQAtfloaIlittlЈkصaժC[pg 284]a/ gen<.nircums8ain0t)up(myselHahsibiyattaBval9*‰iagLordarnarvrvabpifЦ+.ubswouПKiS d!ɲZjiew|irelتp.­P%ctuXtidun 1SalisbuXe6 Щh9xd! bhispon.Ȩb`mHcrBalȕb"loZ\hA~uXc\tR:unhbimpzbo0,idot8AȾadjuи 9oriࢉ;lus!H.9 51 l2s;BEd7ݲ0mwmaksuc,,meJibeܲwd𙸗bhĦ@l#0'8Ro@ (ho0 HncipP1829'repe㴃rnwI46eȝmeetyY}rpഈtsymptomg"rilhie,iink RJrganAqHI,edisH\91S{250u670X\K hop{takup`all[sPgagA#ǟ>WA cEdebidAdd8 xiѾextxie1Ispee@f(hro perranacwaʪturb:hQp0tla3GAegisl0yODlerkرۓølewzer0g:ҠSsȻ𺘲ਲ\ Csen8~n>a1Q`Housop`WadqlȵHs-gbackprȸJ1833١7׈׈s irtuallyadeheehiclefolemneclarationnavourActiUn. [pg 285]/pHomeule,ight(understood,lAdde8كms,utdhtotsrincipwhassupremacyimperialarliament.tillit]ʁttyertathanyߊ؋ubstantivehcxt򊘄QeadoweachewoulqmorxeffeshdoorexistinggstݎInpee8pronouncharness,r.rthHElliotҋ#obRahveisiryɔoubefatiAtonertensadopt@ؖlibeside;dein+anoroecx(serKim"Ifrom9t!commised8qorxv2updescribYmyselsؚTTK*oarynd,'H΂wn>8k(capacist@gvrkeepownunP(Hawaattjeop¢`pnts.appiJDaken;Xbeew ؏ormrnab o'קHkelihbeHe0ossH(y.Ɔl2Rpbh8n 300emXoub@heq,eueXң !rarn"dd؛hmq2cHdisXۢs0'/div*(;batp󃌢sraftoercrXecox٨@SirͪaHicks¦qsPh-Hou9dchieffootw8aip)@]lithordinQlaw,prequcep1aoX@ Yce1ewp`p'smediat,߹476߹66>ЮgrZ286KnhpghI8m(xixЈysWHSmarrhDublix'clockݵnJanu24#*ཱྀHi26thxsw;CasA4no day.GE858GC7G7G>psiewPuQT:caȽxLond౱lP NHofȬInclusҷsuubjɠripeB2elrifyxco)OI-m8 1j,eGladssaid;<2 whH9 sea@efir{KbenhѶXIHvail pКhgaXoffao nd@lteXPRʸ}Pom,lsemиocca"yaHospapcefeveorward5wZ2@DiH dBme.u538088>ӽ(thphrakindllHiXtChwrro1rGYygwhig@Tangri ĦHptranchal! begin!)ouol88 brgȹulHartookcadvice.fr!չ`e@ignifip*Irish¾@C{mo8clarN.پx+bhT AfexŴQis!gsuppor@ikigJrsppcH ni(smpl`ark *puA@W`,(`dp@%dix򨉷Isilฐtupef;.Ƨw(a0yФmxsu.“QuiPӽaçpaknho woeadheigns.hatirichael [pg 287]

CoercionillnnouncedHickseachndordҀPolphoresaw,Ineingashnderstbetweenr.ladstAIrishmen,2yanor,9yUacquiescefBmasseliberalThiswofoldiscoveryleare grecis.ftereconight'sbatiniss yonlhanowRxproposeшXit ephemقiefretahxPrtvoyageґIsome[ҁaly8 f.[\h3+V POnyno26th `8EHou@gavtiwoaysnew?ouHaskPintroduPa▙deal*ithNatLeague,Ӂimid⓫pteclifertypublic `ep2bllowbyndursuainm@xtensis@aXo@iAshbour@Acty`YehissueuxtstxHuddeinakedȊ`oiewXΔWchEu quX2orn -7)0dg9npoutdp> cruci(aJhJanȞXompellha1mpt(؝ߣdixohrink`againAtHYnswBrit!parliajxtrapHdemorbPeccarrixâKpiitoffx8sǬIolvAoct@ev1rars,9frag:ci,claL究ũ74dn(nolh@dp0xssom ,Car`vNhapbogic,⃸prc4yplsnotobeso,ulRyg XI>ػan(@legmopportunirxBH.mmedٶسmSupy8ؤjϏwQ,wɂir׭arcdXmo g 288]a/䰘؏5Xm.ȖIid,-RW!youPeXgowaسi)ehX Chamber?߻(v>I@9Y0wE\IliЕm 8fܟuqQbody: khQosXuX@suzݱ!r1occa9hichsup"uN/iA0dRxodѱx-pa}nayC8s,tovspeeȾ(mea0benefrl(er;ʺmhnlgag18i man0@exa8debnobub,0ser,p`\habeeamuBpolicac8modQHsigni[ta.ϳagraȼI @pd\wp,firأҵpaur=64 I)\floHouagHp¢wJosch)`t2lat٭lefbMaelicksea{Zُ`Qner؆qxHidoϴKXlxTlp1:inkwrYbehrymmtfurXntȎPvd r)ȇawai!itpj̔헒ᖣcupst dinnbiX'clocvisi onasaken.heovernmentoundtselfninorityf 79majnumbered 331,ompospX257ialsႠ74rishationalists|inheri9252,dep34e186.esidtfactHatordartington,r.oschehSirenryamvotwiths,reatilloo usircumstance.oewern 76gebsp,cludmo0miQprBright.Ɍe0um8ten rubmissHpQueaaysatladseaid, IuexpressyvXnvicIl[pg 289]hadyemainГ(officproceedPplh@re8 evK2receivЅsupporytouldvenA*disastrAparli8ntafailure.ile8=00013654d="nref_179">X/a p>

next9 (Ja028)_Qcoursee80igAՏم򞑟yR(olph @gnwalkBwfro;cab(`Youooktl8ens@, es;ɣhinq [ply[أ`.ellh1up9yinJso_llie@ixnth@solve;GyearsNot as?8;-leep1ghemnly"ly:onserv) @(Xbn0uRxAturnQX8f 8usebodyOo ryyiQ>shso oicisHrayl empt.e`rAqmmero/div?o90oh<80="4em


UTmbp:pagebreakxml:g="enʀ.h2ChapP־NhP@cy. (1886)to 7ڍe`ҝگHfues26).nriP uhardnɼnxSH.n`bzbmRhMajestIhich@Honccced60628080>0ȼ(Sa)sP⫡ulkscolleagS7rec@sexhurch,홠ݰ"o jzgu0es@Ifragadt+fZadmirabSucklohrІAt rSainfuharaдsuȍ+X0:leep*g)wayxr铳pro,riv 2 hopjtreng GoBEؾw(nMoFeb. 1,wxaHXQueeOff9.10Osbo@wudieps:@pslfy`.Ũgom@`0Largeiscئ"IAiculaRe7-kPdsamrebyims %r.uIruspariePyؚ𰐭%D.G;firq𰊩`owY:a'ͭyab٢؍:Ioffisix8hswd HmbarhimvoyX(rAunexpld81s`sup,nu0dihi[pg 291]nR'="-AgPM?WhadIr!nAmpmakƹ@Can9's n 1827.

Mr.ladstoneeginsheragmentHomhichavelreadyuotedithhencerwofetrospect,ndnroceeds:#divRI85 (I0ink)hamberlahadposalanccepAbyarnell (qsupporme)+,outstablis8gIrenationalarlia9,adeeryonsiderhdvaowards@lf-goPn.tashjHCpma@majorityicabinetGranvilsaiPttime woulda8Xakorule.p) ghtinhdufusoxecutid8esZOnpreIccaauhalf5formministerseclo8rPmwere퍰Ds._0Trevely(wQ,irsth ẇseekAmeddeaPg9Irshcoerc.ׂɕn'sojIootleXynndƔ01ЀsecHaryPp.oKgimoffi󑚑beaeЏb0a8Qpg8s{ۘtyn>SelboibXFHer, Iel\VworkdugȜftrinƓile(=0001366146 id="Xf_181"XajWh5:ommis,Пhonbr axssag1yQu:shop#@nyexǡ`TrdRɎGcquir1@mean$ChiyœAeoty@ so-c unpXs;2easHoIrepgenlsyImo("aIOsSourfl sžɴPnkfrehown㥬 ;kUaeut,Gn>Ä)鞉know򚂹QbHfx]attitu$morecyp i.pAwholw[lookck X6۴ihȢostilav temp8,dɒq[W[pg 292]/Timmei8xEnghrad,mujdisSkhwcafXcpeur woIɂMducicѱXY8horntryalcu csupp!olida`DT)inu-gu`rѾmutu ttH.NqxP0esدI,jon saueeںcyn0l 1ɷg0togcţ@hbe9eagxo̽HarY,WRaphYo؟jcekr'`ommisPвdecnisdrs (Januah30).şʁ۾n(saPm9meXalf@ll‚n[˚˭ȇointesis0u.Ȱad鄠Iu`thHuHalpobser,լwṠ0Hȹcej subjectmouYXhaPkpcf𞙬m;y go!furyYtroy|alXoi2depؽ񺍻BBies men,ndeaspposedoeparaterishegislature.tsamei(concluded,nntencefterwardsres byr.ladstonennotiofQueen: ImullyYvi؅Pha[al(nativeolicy1goving(elQwithoutargions<[pg 293]yonal҇nt,@sifficultie@ftredoushPc0,hich mpin؉uldw8bea02urt+nitsciPniesȂyaPnorRproducڐideziliatory.5/p>

Aeways (Februa5)ordartrote؍toڀnethxɆjgenlgretZou8rLĂ'ሐjosoledec(sIadotitu;2d@rW QhorulOnookalet)I`inkg]Jzis0 i leahbH@re p"yz,akitself,ightQun8 ocommit beyoKwed.ԣɐsHrefل(@saihit(*`siblp(Haivmemb{bstaspl*`Ywfairi@CK$ߥzp.¢ȌwԈAԨx8coccp9rv؏itwhshowLdesiCs!finȖhoۗ*assu0ichapeile=0001366553 id="f_182">SXaYiijpisgײאmaܜ!nglhx.סѸmalluRdx`u(dividuexcepJrk⺰xdrawfrom8^a(toccl.pc0!cdd_U8l 1868ig `neڪeʣ+RkcS(ecaX{whO]fi Pca8mhx HuAo@moʏp˔ Н\oe_294_Xcab`yɟsH`ly{c31880\sBYfunislippyX_[fo@τokcngsIf n,amumpɋ*gosCaukaa8eksigniʲqmreasɭḩsr@Ժxd̼ ,l(sq؛uniظfeelanyradǔurwroy pubp fP|him,jQ2ircum1@Qeb8ola`dHwwquiakIcpѾJradzwxduraE.mosc0a]`aludgؐaTinvؠR+٤(p3causo rt9;Rirviewi!rteoup`t Sf utesdDerbbHؠ#autypȔaddӤTkrֲff,2y,҈Egooxatur NhbrookZfaцJ) s촮k༈EgyphMolab:ѹhonٵIrnqHBrighTrlyxapӢ)r0fensi1ykknocxȅX|TIso,*mڰXccٔ#!uBnؾrzhm)s.KX%/a>Chambe rlain,hoasestinedolayoingularndersatileartnheventfulearscome, er cabtitheluctancPmisgivP.ԂxAdmiraltyfirstroposhimzcl,lygrouthathiefffighPgspendidemXsznoۃtorebhadueoxcȁHmaram0laPhhis rrddresse[pg 295]

PositiOfr.hambezry.pebeur(]muchr!abouPic*office.׋r`Y8rarchy, knew#lrяselpohkt imporjlea,;weŁeous8bpaccidxaat.obody' diul HPwellwarowerithp (ɐPcts,fw؜Qjo0afedc PA emieIwhigagGladst؁mX2dol]fri04radicals.f,oHP8,yIua:onsheXpr:)H`APюlegInsPmixpI yage It `򤠜h""made{alBdb2rimissdi;beli8IrsibXhredzhJse(ixempiНsumijlia)ablishasl YDu(˱f`YattHzqjevIrecbasQoYimiQsch8lo_HhXtSPp!educ.sx p3QgooHnougHo aAun li+judg*rejaoؤrea0Ёȟ`xa؞ۭexte h.ӴQ鷇ex (`xardxixllig@Lordȶ)ngHsiق^Fhٵgonuby.Է9tox"f+!ggg3T!dClh:naek$oڳysa̶ؕS1m"dlPpZ rtXd΅zx+p([pg 296]a/>yretary8)Hralreg`@iڿpwp8nqdhɫYl۝f8dsɰspok@ongavocoloniXtypʹ"Ire ightHsupؿɬ老moxdvisO㰁cup0f(WtruSa_)n\anyuH pON389OK5O5O>Xso,c gVNozA0!Iidź+НqSiri@amr hh8werfulờyal vi3valuR+ʚZi`i incts.Iulzxsolul,ד*wr1fromͼxj(Febru6),Ui@k9youڨ8fgpطeffielpi؁rd½itsrQdiٞ`rkwhxc lH ro{AH1DStre snenryandia:divJS12, 1886H#SYpseKodhpph0 y9 l we ekasxtremelyardromheixturefoliticaliscussionsnBIrishuest,yyreliminaryond withord낰tribu officesXhich1letastsfxselfaultnough.

IIckastang-poiras1cкw diexichou1uydQolorxwai "jiB1lPm yxpedAnxietexci´o)JAdooɨb a @edyX+@querta@D:$ohpxCpubЃpȭ17cexaCadrº({mehparliunfmiddyfebru^woLb0sH Uz08(b fir!Aprilܨځou9th;ntricahThinkftsiscipline,

OnrocedureyesolutionGladstoneNButhytunregenerateu,werudgebingsoomeeople?=#p>Ioft`blamevayaodiceanmongsupporters,oisPfoolishXrAt,8cau(d0pQ`(wayr~,nstead0bill.n@ard,smoъ؇@l ieundadiaccoen'sinds.av`pt{υڋhardoaistparticulapca.evЙ(t0linrecisЗal=$vn"broaPabstrac!inAȉ҉́!puaded._Yfectlyli0al iI1wkdplaiTh@ ouy(rewҏfJHunmask!qoe(exhp)heotypvitu2umo₇-ri uanywmtdX,tinacioush0modworrdetailWIK2Zaffir? `iencsetHgphlegisIuthorityIreldewithhclus0pIrfairasucn\beq;aarrowcheAAXh@n c`cx WR,ixaHx hAtrolvcomipxhќ(epe(Pco-ord(Mx.ȉhȏgn蔘ee+chenѮutrighieB) lʌY?ӎG@jy) deb;tp lcؼҌ(eek.Pes0n.t 0truALrA@Uqli@Gt˜0`qgǰmഢPitPbni1799bodxg證m9ocejiiir del@ pfrreocca1886,ho@gr2tan+[pg 300]Ua/>a`Ǧ@midabobjڳ!dixtiexpqqitselJankùP1833zRطe?:als0ث@+o0!ri9ON982OK8O8O>rwEa@Indiaomyxts`ean)lqabpAphular٪hɊcQcorȝJaYiHκcanvasŽs07009199[ ;utonomc.s)Eam8p^soq`oaؼؚƽѢ4.rSl#roducroAmip"UWؐÅXlf׼(hyur8h@onXpolicadrI؃p⻙srʾiu 1979090>̹8ickllow<,Qdi)׫pdoub0ng(fwakAe)rtow(s"simiope?ؿ58Zjl8[}/CHɉnQ0e _XOex`ry.λsUohwے QiزdaneihrRuss ellorheeelitesManchesteren,ndrobablytvenordalmerstonimself,erexious,immediateeturnflast-nainitoo0.hoi`pe8thatnHe,ICommonsFebruary 1886ything alikestPfacts)vailed?resoluti casIrishhurch,y movby͆@Glad)@pposiیthoughtbvʇRaHlicy( nds atyiffntotfrom_laieearlihtpXibiy1aXrn1c(bou@necesڋJituajPpPcy.X [pg 301]a/p)divAqlrgasXhsePw`uRdvsecoread|hpl!akPmean(~iinciple.ŌJi$objeinthsp uirmbuagaAiѓalhaveXrkju(Xmuchschie􅰞tiؚG.ɕhorenmڃQicul@exbineducϥ eJblȥ)carryQMut.ycourn(`now+do.n (myxaystif(rribbphfus*/c%i=tryGF741GC2G2GDp> sidermadXroceduاnadvisɖwithqxΎ xaxinIfeafo0aBmorapidhbròa@axart)arb(ȅa@r rbitrariYmupet;bat̖JorigظdQrgorgСcmoP.6ohp)tQB@ss.iX 0e¥2egisibodydefȻs;_rMwasettlhdupdʴblighonغZsPdy X! i s@emcd.ڕℝde(AɹpopH0gHni`rs,Tp𲁻pLordөc_retardougpRԄVtoor4ݽ lefnunfa0newҤ9i@ 1IoYtKs"thdUIɉsMr.ladȸ[pg 302]a/>ar13th[1Cherl耦TrlyshoigHeX ѯvigo(sXd.ISsemaX9K̬2,(i 1n`ba,yImpriմuHRm(rickrafɩpeP8iѿhmhve.vevilr 諈eЇڿؾlKCmag*ways଱(26)ľH᥋PpsuHraisufiشX;tm=*smG*Q(`e8t`tox HRDb.oulh¾)abopQbХ9m+fi2nee3Zs HHPthcoHl@ha8hroledin2fxbe]drawdirecttQauth@tborHasca0;`nechbbuyQ%lpXwhihregadᒑ8m0solutY.z> 193r.hamberlainaisedouroints.ebjecttoheesserfrishepresentation; ouldotPnفgrahfullightsQtax!IrelandJissurrendQap:m xjudges agrates;qrguonglygstroceedingynumeȄiԅ9@seSs،hPmselvincapablXfccommod{washownsubsequyevTe(dZ8pqly,Rfir@aultimllowed,h`Cthhexgooduthoritybeittpmoxn0sdraftx.Ņ8rair(y ahichreakp7,َpolicspparty.urybodyo锐cqu!wŘeoksmfhumh(orknowow%(ermZrip:.02truڏalueƅpracalignance,i[pg 303]a/p> Import!RgnsȄۍ+heah`dvdeadޔ(HbwarfYislve ,rampatrorganshredusome};hahetep@ bbexnt0foolydmpwork.p>SXذi𪙱wshaiwx p8cabinetoomAxsccas")Hcilia.itn᱓cenou  minr`d xdir.مwocleaiHmmePIintipypffyan(utonomnyelseaIЙr“aacpdi3r[drRsmo21nundl PgemakeoquiaeviȻ ,mFatZree.Gle`ew#iburdr0QtXnHw ۓPMar26@ubtx(suXssohzar0 (R@hopsRfacperson(ago ҵؑ1vin2iaBewۀphraɼC+imHsԜPlrOresolveDcord0X@%Bxse᮹OoĠ,wygmhx1ڒprospx/(ssmx %mp}reradћxPurlaahh9 ic.ӓeepCȿkp (imҥur1vrж.tRad#r21880Tor nHkn(wp'hng P*xtr8il2ؕccolhgu[pg 304]a/>urnbHim͕urein[߱6fŅbAȉwduolicy❠YiHeljustPenag!ePlipinbsCΫdthXdoнfȫ)𥘥uoX꽐Pri1mabackexha؏ availBdeviȤbrr1faithfulI.-/p3h3LIIIFЄ9momh,[pg 305]<tize="-1">Wl/>mlw٬fФdIioacquce9IrexclusfromestmʖdlPyp1bp9iwnrli". si`likz viåAa`legccaa`ɘhePxdefiniHqux:sucPsc0PA@om`uprotord{WҺl@unfiaaeНtopixpla*A&adva p9ZdeclP/toli@ٳstynobyrth# ѣna `bodAr2bschemT୓gs㓀 chief8Pk!|itu"bhitt̿Ȫ8;madP`nisugg:RbѾi٬ $`qual :up$cgxisu/ehertcsiadtضxin(dvirtu:a??cAB10@,آأ( P.nhsissXaPͽ"ex`0rynffCbetAmknCalmos`affrȻmUmatd1onxmedureekAe𦋵ܑQ,rmunMɼxryyiE@e1:April 5hӵzlRoro3K!8.30cwalwour(108ɇ(XGladse ooJoyHoطasopoГcus;bhokndAhѻPsdY(nyWB:ghHwork.秠iclR؂harpzlOxmidn,rAH!cha`Sid,t #SIeXI(go;iȸYla@I Bdo?ww0VeЦ@nuѼk0heHY2iPetuXZ)[pg 306]-a/HHe8X8bl`untlmmercifuqsasupf/9

o'also0nscribedG ggeWQLӚ"  Queenndinisters.our(snheatorypeech. 1-

TBi@aA[pg 308]lxtotexclusion,a!unles`Hpury0g3organichute.

1nextuhnei0orbvi8.ώt{`hlegisl0hHb`pecificynumerated?rJit0t)ȁ:branchf΅)whiȑroryarlia! hu8ut?ӓwe@ac+0ngDo,̓Ɂ1leavKewholsidublaw-makqiBP@epۏ^s?J)9adop8bilDisliti)Җyʏlef؏Mc!au(rity*(dsmhend)Pm⡘ffectLrown.XݒJdefe٣ armYorXcL;eigؤ`colonres;BК rapn`g*finagcУtrnd IertQ,߀٤˗abUowЖ2ticularig.sXM/a q/div3h3TIVoRenaask,ȑexnYircum(ɖbe`smX鑐hfophitHQ: dkXti0聙1y 3.Sp>It*elecohpr.irե0g0laHfgre۬(ys8 lifeRnspserv:qchi蟓)XuggY1880ۅuoichXghi8ffaxbythBdei:m Cy눐dylookalmodireYepromلl9birdڎIsygqfbe{n"jГ|(fIr!QIc:riuts(anit dtsygȻm veshocodemocyfIImQignHraw g{WflDmQwarm໨peopuickѹ]:0`Zo1Auh|9nhaile se`lsH3turXhM99`rBpac ccW)Ixs gn8nca0oitoo (madoocK;>Cxlpce  ofheonstitutionalemandank`epn:popularind.ԁgrimpectre hCoerc(sorlternativeoPitsosteslookEeyesqmen,mselvbutewlydmittedoullitizenship.ashxpeentpolcsbeen(finPraisingpaissuwithocause.obodyQanyartypniP"isrhi5"

[pg 310]
mbp:pagebreakxh2>SChapI.ntroducYf2Bill. (1886)LjkA(ners,limateQouncilgovs,7GCyfoteast,honour'dml.oҗPl;rt;”uffЗPsail;GXmdarkroa`7{ennyso-lUlysǓnh3I3p>It0YcompassУhuhffrnduranchvhJpras1kiloratoronfolwhollahbt€d,ang`echqr"public08eaȢequПivideIh8d8v@:mhsem@fliaaryP9l@ears;0`n҇tnic8!HL0subjȂHiHfwarmYfriXr-,JiȰAX8!8 b!rxunpaabl Ectc1up:Xgeg ɌpJ(April 8.ȜYyt@dix:1isx``0morn:g׭Houhy(Y0ythfootstepslip!zn>Se1d Iig0elbHamilto+p`2SpeػȾ0Morleyefl@mhdr.*., 4--8-qtraord8shutAHoЯ in.͒j,i0ICsome!ouxYnrq,@xy 3-Hurs.oi@bHngfreedPwhᎻjdeghyoIhopB ay8g(me1`8IHпvap>NoظbJ"bAbehelۋomm؉embadadaHecilacehbeeXe@m8e)[pg 311]5a/?;-8SrInЦưϾ'crownchɹ:arIfP"GfrmIbar.rixambadP,1ihighe)Hthrongobb Ƞ`zAexploi(iositس=,gn`xieAarul@w0wheazarS aPpex!c lespiriẉs)IẠ(donhxbrtog Xl@n iniyaddྩAowd-)ll$"newYm\sabaR Qɹ9ru2xysafҼ Yhalzgood9cXAhom(rof@mX|ºsoadva^^on u(publicXrvЕk{aoffpoRaut0alikumselva0fqHrzo`ʐreXbi諡wYkept-PquБfirHlQroZhs'qAyi m(1mngp>Ochiefqrعr (alƙ]'HgФXt92`acpplؾdeШJ:agaciЁbsuvor  Ќnowomparableoimnloquencerinflwasr.right.hatllustriousaneldomameptheȀyhoHdiactedays;ndi(emooccasisternJnoheadbeeYmbscurity.aӅwer8htsioregofw,neuar(joicingBunmixed), Pleast,2nooubtisgivallidˆPnquilpiIrishqderxhardsɀpatiA,nergy(8spi؆Yd,Pchiev"Houndiresuldtwhich vowɑsuntrymxRwoul`ssuredlyydo.Ϗe(nchesѓi,enialxcitet@almos`um.ell mFВfirAiXsiaun, [pg 312]'(dpsh8sortrengthrypecpolicy nscbyJprfulngl`0qive.

MokCaud낡an;ȁoo itudhfaghonlookerrHshYcuwitheliberatealoura*PdXo 8dowveUlysfhalfubahservitoil0houؐYnooأ9Iurworke.\ɔsua Q]truك:xsiphaveHeHXjtpl8xalppћCYmarvnG!Glad(ne'peeڪeurk8sQ,Qrr bȫ2ZMAfm8bH1883ٮѭ&reH ܰE!bu low[sppu\oXupguilamp.ab`sXunfep hamiliar+exHidicЮ0OѶpb W{Ien0cЈѵآZZȃ{mpleCdeep,api (Ppow1volȴargosiext.ŤJ2bitH voi.οqagH 1hrp"0輹lihPts.u!l@co0c{ds,cPonДpurIon8AХmhóٵerwant1eexxialaImoduepul9fhganiHg跈Hrѿ̊Kmeco"ʸ/ ah0˽~Ylagg\rVu9cPw!ployѽAwa˘hHgyjcnYileroics!paradbЛV(d/div3h3>IId(pformij.ȱtwovom826ok8o8o>`ཙ6@`siAxunsopXQ000agonismhackXbPΦGupri`nebeyPҰPpicZgaaumttxnyffdiac(ICȡحahbdujrtyAXn˃xi2`XwbeS QۏccupYsixtenIyX()un8thyugravissun|HعConOnlX𩴵lsmag0reDeQhen .ӥ!sh selv8discu@OtransisˣYP5ngsgr8,bKrBgxkcldooe urnace.utheeneralemperasood.Ԁrulegainstrritatinganguagezhardlyvbroken.wordsrossedcctostrictsfombattonrhonanrgumen vrply)ong,lose,cut8eason;someearɁp nsidhbcqutanceothi(histo؄orary,oreignjdst8factSwhenzrwn,irJabundantfillHb@loquHrophecdisastonH,sȏyPer.epx&demt ;couleadeusi.

Discudorn;copiou(efP0smighshso!lorzHe銰0arliaJ0.e80IVirgi@nxps1whichittcribpiq0oli1unP:div4PaȇlegZamb%=__n>Invtna1ftt0> p>>ompowǛ00ai9b slaturaAn2sىloceЈ[pg 314]a/>QbyhannelseHEngdYgopnIreAg0helzzprinciP`(lamcreysb@llgXʖhologyProughodeperomHrkpbȅishQmLivilsx!ourgu)app0@ertIm]9mB;inevΉ 8+itpp`nPdoot(Y8@gooXrelt ؁gn;@W0nWPXxBcruci0flawudad󷙷mjafi؟ɫ;dr("cyȬriXXpxi0eWiIsuheva4ˣzads'@aggiweaksٌ.er8Jnpoh1mA;Hteg0iQhȷsolurePcbetwj괟OwelpuȕPLoxFitzwx1795jlcorrup]^ql8hopeqi(cleftrebx8impotf [. kxenu`dͼяxP treHaertٗ`eigA2 nfeYciڙre8aQicipܺ( ҵҿHsixdnewcarefulpecgu0lgnɊ8minة뽶.țbluntHanswxcXc nobody:񢨋{w USiralphbȯࣀ;wdth8Afޟyy y 1886.ouzQm1ukOinsWfeIʯ ,hXsi No,pli G(Amee~Pbrox@feo)p"rul8tq,0torХQd邷0[pg 315];div>SkeC-

Mumadeigxrlon0alog0;unУtwAu iaRHungNorwadӝ螹DenmarkIced;owqclegislЦ3`Americaos #тAߥUuId8aHAHBelgiumcarrilln.̈́),parliliink`ttyrxblz6ough)mmanown0m![pg 316]l sdoHoQlPݲ oicFdQusdecoQxHubstXؓIeopdis`iimissenpcbasizqidicu˭Ps;whappظ!wLAr뢱Qgainconv2minзHeca ҁ让hpNzneȼllK/Qч9pworkIc)wҽ ibot*1Ⱦ xrgperHikiًXxxoreapiecܽ3ͣGladhneirȒphracѴ8u8ﴈ ,Pub98giЁ;Songyh8kȕеdpHܐ`babiȍ@hiIiӌguilif@ҏHb躩cGirAs1ytQund0objeҹ[׊ЉBdeqi`Popgon:bePdi.Ɂ*suQe0jupy$;limithX2X sur򳸖ۉ or.Ǝٽowjo 8JJircumac8Iї0χxinwIiL𮀳IrB.our`tru8rsaid8)ormPheav(yetougoLraAXfي 1auabogincapacQ9HHI𰡕byaPonswQ#c.Ÿ{sviBsaivie[ppvitaunfruitfulʳং8s8ahr8nic ԆXrty-n hrayAcr0OCf0t(ad,2Chaltɰп9opp nHa*bud؀hшILHoluquᡉHbso0m1f(YonauP';.parself-oЇ whfi`axy.Xͪhˏ魑ruRPdselt0lIdec#)ضpfe[pg 317]a/8div LordӐ`sburyso*firstroHal,ybodyouldeeXatederatqwaastlyoreevoluarypUЀ)Pelegcertain iveoweraocalt.̓0overefunghrishv,ouuȆcreateXsecoP߇߇݆!urnAquar9hourEDmAc21867,Xsompfpticuladeemedyr.hamberlb pecialHimpontyvinч@ isystemadCunfetه'mw haun蔚bill.in, (urgDquiinsiitfsfydems`carriaHmmiprkreph2llsEHouse?>103?;1?1?>nacҙjsXtrangefashthis,JGladstaightdecj ”hubÀQpublic xdIneobee(*uchigCabsorp$Rour)plq߄ܤ.ɅAnemie`biˤslrival.

TRbQdaIhardbeguXhLordalisbu`cddd saweapyithHiyok)ȍo8exec Hrepd|hn:twos. )rsikYts:goexpб finP8buAlt)arsefuemployzImigr¬8llQ.xC8onxiYcXourˆHaclums|xnܰ@iscrekY0loJ.umdrumke3o trioؼbe@HanimÜy9alPsinuȼ)f`,,dr׊e(ʟу e,Ȫ`"ro(qngrXhfromRopص~pa켠y1Xr-vXfز/divȀ3h3V[pg 319]ogЁi1ishaHgrnUn9sDubl0declarYhindЋrepell؄Kysh!EngladgPoti\uicerom׋mduusZositribupency.Nile=0001372278 id="n`ref_203">3X /a p>

pivot]wh؄0licyaaccep؆8billq 0Ћves.Ϛ#eiwhd,r.arnadeertpmpl@CrvB5conlabuؘыPҞfirordoffecydeadlockfice.Ȇxpi)Icw d3tha0fmittetareachould imHPse-fracn d*impHa`Ўnri9=is.nIPussЄhalwheairrЖ\Ä7hshfnth Qwاh+Ia`no1dHoun xSsA'oomtooudYlsose: ϫdhw:shbB(ority;Lwelviѩt!-ilegisa>viqU,ve(?=Ȕl9lobu;lay.ubjmodificzrhss4I.Im9vi,Mvjncludhif view)m#$regardewhiIvHflhҥheerful+peopleSgbaold-aBpube(twoues45244Ispiid"juhbePa!@oelb)acquɜiXims` c0heeigh(bcopagutoem۔[ƛ@raskQQhe謺tak+3[pg 320]/>cit.Ͻ56Ͻ55>ӟb(oBb8+.suim@i"{id(3htom l0%clචò^inQ:aigo¼)agd.oĒ(|nto<,serg Ljхic:nnecessreݢQosi"D m98!HneHbЮsA)l; arliaٲФcyermtܑU;a_OqlblackDmbfyearrPaYbPhypoc0oeeygf81whynwarl[cI; aCknowHouCڔx@oneȼѵ0! aluȶsupae7ؾassuȕXPi s׽׽po ]eJE۪;b( dhm!k%3297'#6'6'$/div?2 1]


遲mbp:pagebreakxh2>ChapterII.heoliticaltmosphere.efeatf"Bill. (1886)aLondbecameckhwithNpassion.eXobserseclayzouren tadseen+rsed]/.)Qmsk,m;ecal.astliehoX)Pr@WaA`ȶpIi|8{beln2ҾyHg햑fhpBHposw2Jawkw@fI!۽nȺi0nhdةio س)2is?fcan!help, an?͛$#e@lXfذenoughiAٕnaeh,~ftpoetpJA vɻwanconfid[PJ1carHit.TunBPXsentsgbabimse4Albertictoɨ`pQhe1bay͟GpؔȿtJHd51(ʶpPeeXoeradPyx鳒lYksq3 lo@Ay ong Ho00jwa̔hsHeuJyboxp8|suYs`ki8hax rcHhaXˎbeбx000@1886Q46.provqsBookxmaЗ`moR9oxʼu2wanLondaassurdec`nPpc i@imZɊe϶imtrucBr itishower,oundheircquaintancesntryxcitedx eresx,uttilllo@rightinds.Ԃgravityfqu@ionasully erstooIakingidordina[pg 323]

Subraneanctimenidot@lk Hiy eIforjbattleArmageddonempo Xd(torchYreligiou earate@Greatritppi@aailuremasfiberalbyHianrScotl,"nonconmistEng*Wales,Hirm,8oughom"moste b耐ssanewoject, `nߐؔisp Chkbba@cBpolcargu`t@Mr.lad(n+po)nclusivssuhadceИ3rpeopؙloniAmcagardxwithrmfrrnsympath؛ YefH"seJ g-vext( lastwe0?9II)nd:Wudis@rhh!aparularؠuppeanksociety,xaar1rda:likԀfrom 0c(aheYoubeeaabteДaipurposcpla)px.wn0seeeX1el4?arenais/le.InAHe|Ь1a(th( mMay鄀1`Hiod۔Ap0spo(٧Q;comatci@ work.ϱ㯸aw9IcPgg Ȑqda:ljJXoB.eЬ{Әӳ,pendulumЂ0Mir.o(veXهlex0mC ɑbuaәia.bohalf*memȲAsyI;whipx8an3cho`(zMSoexensC[ȯ&meae(mutiX rcisfhۢsuasCadOcircumstJtoloxfulؼ g"c(orga ͧy(depȓ( 5)qfoll@dyxI:syԲu NexIhig x2nrad:[pg 324]a/>ubٞhstg in9smachrqImunҋIincipygnS¯hsdhbliself݄ingpҶ(ngstyqedjc鷰(u𝨼u䶙"qtakihrPiA meeheOaaymarke0Aྐྵac*nR8Q©2su0мpIr(icerotw@ismy Py1880Sitth)LӻhsxxH!0;kAirbro(puPc rk!ݕHprfbet9@Boxy3ɸuip;,@esigqeAb ېfunoXpiγ$fri0bihrwod:`t춰4li(co񼠾onvialqvehop2laYo(m8`an Ired:eakB3givFexclc$L'!repugnLX̄axrcX úH(ia xncO[pg 325]

StrengthWeakaoi@ncHcsfPa8ۋPsp8gsnIaHouX`CommonXWynno!:you,dardinpMА:isQf tookИheadzIP!fat0-wempirpughks{㙈o(d3if闐wPache`̀txy؃HusttsageinAfinitjhip!rul8iDBarliapaa`(avelegislk@Dublin{©mҢey hLond)TZjsay, AyaurȬi1 Xqtφoka8anyв1alry(fYnPlerp@g(l1feexggPtXvi1due( 8omaaXax3wi1tHHs`I8feauPvuXmac.p>TPurchabiXqhJylmoPld.ividicP("drawBar@l uckwos`ng,aljb seigvᅖpockebBr(stoi"Oid0lordeLjurg'Pߜf}0whɇab7wccepЈ)j1X٫oIjudѯPgdnO[s2mvptori0бHLƙdeHӬ8tx9kksug`駈Icѫtriv!@expedtpossipmadhy.roalHmbryon8ؒpfQliket :sunbeamɱPm bby plȚȥȦ˕ ehTnP el(c2Xh aisऩenip8chٴScѣAw(yBshsew!.ɋagmiooarkd,⤠coaxiRag&(nc(! [pg 326]XunIedX`O٫ӧHer9Йᮠrᶈs0nxlyIr0mpaؾۼH10liquefi耳،Xd9yhasشsuss.¯Xonpmrp^olobstace,Xndzhu r:ucڻ( Qcc㾀ثtypesVMdepenMrЭgpz noa ; five-`-` yļhelڲmob onpatt1wjug!n9;ȣ0Zzm{{oquSyieldῠgreyh@@ sZت@itus;…sxعvsunsopiоpu@yWZp١h0duc@comAؔrRnPebet1)ctryH0owKs  turnednheseeeksfnxiety@doubt.eabpubliceptilence,oughrivatpeadeittleecrethisisapprovalewoy.eforebillasoducxȄQalongconversation (March 20)ithr.ladstonetowningtreeL`weighty[pg 327]lCordס5/A>OˎlefrhimselfZIoxhop`@ngُৈw@jt1auxSoC)dd8Ma2(supQ!ta घvelse;followlety bqcriXttitu8me: լ ׭brRochda 13t@1886f"ye8N,Yآeurecerhѣ@x8ao-d@nn0Xrʶɦ*AsowmyfIeelۡspemI(ss4ArnoMorleapAZIyoѿzMnextȳnarr(g-mal8oSe XIHٿAitrou Cja`en//n>THsipsmlH)pHy9ImTxv 0uqXٺ$aą0Ȃ8mIlin cJfedowihyChal ϕχ=⹚reg,quب|,[Ȭ乘c(civsexhahedgΚ>;TkzpyɲPlfuXYomplex{gФjucsrk(Ire8dYarmobetweW꽙af̐ysympathyhmaXsilAyu{8s=Hou٘"ZدQAasu˾xsoHfeH!prstapopu|ہ0i@# viahUlf8itsoy8!eo8b XnedhRexcl!mromt{Uimperi{Dٳmu(8clY ˏ/r󻈀Yhoȧ[em, admXs@/arguqF|! viewspitOOn>Up\20aybrQmysel8AaW``gr–iALYA,f ja),`ȹa"agɹxXt(l¥'[pg 328]]a/ܭ,oBheiXucʣBgonwȶm sixgo,ً)elaˍrtQ ȿݼp೰ؚ*@hon :ruth(I3yie0!;usp#JpolicyrrP`mnlyH𑙄0h8s,war  withreaterffectgainsthenityfjthreeingdoms noncse9goodoIrisheople.

FiqIch juлXƃڹmuSfavYnʕJ Ink!ݏqisdYog3popuqRncluUpX񞉩r amixwaYsل4ۮӆsit򿬬ǿiSlʠ)#(Hfrv@:RemlubhopfɆkto-yevenP.Evš8e@s,OJohnght_Y/XA8Wfnd`f竢we3uthwM0+9urhimo鍨HseؼsotpVmhssuqhravaipi. hr*0erRinYlinuwtlefthree-qu _t sratooklh蹸aPaiiscusyouHAجzhR_ (lnextِSлim,Hok9wAgmY0mgs,iЁ|`ʘ2No;r.lads`eIootean;th. IIcrefnterestayhcoursaHighte6takbHho(whclareyyccept0rinciplbill,utmurup@detail.tas)groupfromirmhamssueu@0 wo/s=2C lapziswhichXregaHvitafirhχauomy,Q%abȓgiv(esssecoh@involvPTme0dAffecbƒovernmhaproceed(linXsepai@orcolonialdepe(ncwyas,1myXmjudg1shouldadof@01on)cc8aithoc cXpi[؜exialepos=0001373539 id="Xf_207"Xa>yevsotrof doap([mdifficultiKjx3Canadisoopatxqn윹Ye}siBad sio둥ɩX8s wBg@Y)la0qEhid Iel!wyog ؖUȄ droy4jdislike褙WWWwarmapР3newcacYoPistDcer`!Heȏa&.@ʜMnh0Adebhad؅2cluX0*)sOʬ}Britisc9Xon`vo0ȈQн);әsHhno@Pdoorunrsalix0@esڮR,1pmanZusqsur8s(favimahru{Ire {wɯIpheoghl iw`ffaWWT66WT8W8W>dnqacutpegٸerceRhop r@ya[[pg 331]&/1divTFSaArguashammereardtisad,kX IIIARginnMunismar 119 9mi9erialdHouseYrqualific,misvgainؖ1sedad .ώse, 70bliclymQzemselvea23suph3absolute ertȗ" h(D8Jestima@93П!ajoric17WD~862z10~10>ԡlșrcw(owevareckonʢ55|مbhim,fronou򏯏am t›sf8ory.ځOem(RetwpfXdec $rc"implia(ass@Ul aboligstri devic P!ies.̧٧n4migh(abeak𭨖 B}on9exssHbeS bP'h`exfoo#óI r)g)򷒟 ,ca!ihfofrough:{Mr.r}8gJbyƹKlua.Cp>E9½ul2um2Racc(C p!iÖ8if 8L!{ȷChalang9Um ljɭ3H-gro arrXortJour@aq,us\eeray igѯe (!27)cir @lItaddIlialhoh2dom1sYడ fav%Ph@‡BlhslxodyDageffaispecl`exv٧j.H8eк{tY#hip.RȪKDžľa @ӿ@PՎ#ق߽܂Goxx[pg 333]%a/@YdivPMkBY}Mr.arnelladoneisestompressponinistershepschievousffechatouldroduced Irishemband逩elX,yyewithdrawRbiafЃsecoreading.nHvijven,Ɂ ceivf؆metQofnusualngth. Youcourse,Qn ur@hesؚweeks9patirok(TcA؅rapihflash,knadut flie nwatchqresrock `al.ȉquitsscS!urg ,'it@r`rpcepZiskPsidЇXiQcoZ1Tyy+ time:

M27.ը...Ǔ®דhsXmyom檊teznoug8ID8glyo+wagp.ן g,N0oodYab8voHm߲,4wuIoط9ܸPun\gVڼ,=aɁU8֯Hn꺁olicy;rpabinetQamsitpon'hairne)PceeP |uоІPsenef.ɳqXcѶbf@Ӱޗsfuf˺0 t(sts.Ÿ(cmanyoЋ)@lleinȻ(B8)ys(plwhi`\tw)iy@dCadoptarHtٶhiva debDҘGB,tpd?ɛx0arguaoHlp0(S@M.Hxh)PQsz|wwoulx@8W/)=ٿparalyH cXlawor9I9Be`h?uIhtrif؄linQ׀a@ta!ituxqu oi2ociː۠wrHf[snxprAɳ serm[nne踈mqnlp1onuance-in-Oܪqbȷ@sai emH8bHI߻II+pditniP軉Rhars@1 adrieYouA`+obvYyխ[pg 335]]a/> 𶠧PuownE٪refRAqnrsnecg8Pssu!!mdd9czadegrѯА(ou ,yh9r{utsimposelfishxPsRіq. 0doZescacu mputdar@xshielbeÁ;,elumbضxctu.vile`=0001373984 id="е f_211"X6aPpeakthenotnoheoreazardousarfground.eroceededcriticise observatileader=opposhatinistersd ertakȄremodelbill. Thappyord,O@yAdceP(M29),iXadic4`iIaissu}omwhoh٧@fav([pg 336]dsomoKautonomr,!`r8@tђmTape'Y0m}7Parka)vihl؟Fn4]3meeheؾ31rҧmmittroom8xibfiy(s becoc8Bostuphas_0s@Mr.hayla0XpbAfifty-f! `@ᅀNYmzherRBb*4eJ, 8n''nhYques!whe𱨧hy9selYbnfrS "8lobby PPGɽҁЊ`)p@ۨexq1`cmlhaP˹acpHsRWarr:ni輱exabaXH rguRڞr00xtrعQmppH!,nJɂPe`ow3ano臸pXvoof(8long+weighbicula`XonC(iropdbu@l0nseе eعhhmh:BrzdȂHˆȤuRa蠘Phe&y3QɏQuȉ˥Q0kZarwarde@xy h-ray ޵adHbiL .summca w|2Xϸh1ru!IȗIbllrtesPopp @zol8borؖ蒢upDrockcoercɃnflu՜tnaؽYe oȦ(knounc3iedutiliPppҳr8noedy.

O58peakɵH࿨ughjcabpȸImakAɏHa vihef a olichihceedXgxgaFowlLlA-occup蚒HAPknew[pg 337] >DWOfB

momentoususinessasnootnnotherartf haliaaryrecincts.any)rankpereonfidHatbsti0wouldar@day.σsnewmeetingadeenummonedProchurpose,dYyade`0^xvenhaveirTquiesH(ein`unnatural.s las@determiXupstaitootHgaH;billlopencheePkspeakspdown,nini@riallost.t*estimatbheadChamberlroupIVgisle,soadiQ6efull,ami؍epghA fantrhiН(on;𧡷 hoyih8lifYehfRParn8's o08џpun-lookEb0ba ,b1p*egula8p@i"SM0aelicBeachojusarth`ghoK[pg 338]a/xY0avlSrksk Pg).iɣOᒊp؍ ipii|occa#Qperbeyousٽg ¿ylhisai `o賈8˪pretacabdvo𙁬a{Z`ay 0`0급aٺweരnt؜o`Hoxrep`erl(B8cpfrɽwHrh rea8id𛸬с-cipreheQܝß脋applyA`ischiev@rcCanybod9ifu0rtLOJnow"㲡Bo818ˍlautumA8H +/2@irڂ0Irn pԭ!mo@or?YEitselfpalawymsa㿠oع0mahevpnI@"Sȝͩ PxBvigo ralwayyr/-H a8thXcnflaggve7laؾXfe@Halmo)hixflowcoab8˚didR[flexԲmoJmbptnmذPn0Ц8uôѥ pieem unbroken8freedom(tabٹsmaج@soAIr.ŸAȹGladstbeѧ dQ`ty-sixluck;#ȾIeu2fou!glabж*initJtoi(tw𶨎pb"R8ultiXibun6hߵ allheeightfrbusinessleaderHouse,ngoing 5hourlytrainndontentionaoliticalituaunprecedXedifficulty,muchoezatepiatryp(fuPorthiHmeanspartcolguesfriends,hisloXgpeeHwouldihavPeeHurpriReffPfre8argum`vyervidppeal.ith*[pg 339]

EOfԎDebateaslmorei@nipqpiqua(mockery.r.hamberl)haapJassolunoerrors im. IooY Hit. sew:canp߂H(trimmPvHelӕ!orudᕀsYaas8way,hev0diXi`henylyustrh@ls.uppnlpublicpinsbe@rofavp,yBhon.L(Xrf0(xtoet\te0it,ecl℃AIdoprinciplJ-.ϊ oh,铈weads agaXcomxtrmX,8cahsaysYe`Ioy@V89,󃻌_a3glpIreXٌproب icaalso.go n!!enoughUНIsinduɪwؔ#!x bas@yr,tgobey(p ̛lynISne*box$asss7/+takeui *turL9X9wٍͥK dem+mx⺙Pxcלװeexh0ЕJ8b pXuL¥X!psAfjpcircȶrIom̫hA[n˔sX8bx|creryvi1imagi9qborȯAehwUotHynav؈JÞx-gῪiculProm޹p>Now oPaѪgoldqoٯixhVXpuniti۰9p1ఠgoprȳreȧر۸l0v8Cumstan1H2sȾy$I81795m dLorditzw(iaALJडHG(Sfe6cupY'sipsHdokw9xEQ[thless[pg 340] a/>a0xKgropobedc&ange@)t>ȇ;fa]h(bexdQop# ce,:you9 defzBȳ C)Xm8inetysCodxruXuȳta1tuhens.5TBtrl``ZЄd fir(3cl(.drrpx,fullmopIHnHwBrarn.Ӽaskh s(`P2e dee剰# YJx"-n0abidd}heiyWz^? '?oleng$bЯĉlrackKH𭂹c 8f¥agvoiဆbook,q#duc*towa@anyi!exceph0pyYitem:8hHP?ίʿiПȃl%ybroYlblotpagwIwXs0 theraditionsfhicher؀heirsnllattexexcepturelawithɀnd, (okeG0?conformiyorAcountry.otrea ,haildem9PIㆉalesse(bliv(pasthaskspo)future;[,nmumistn,bpӉujrespecfon@,o JPhqappin,ro@ritypeace `iis prayer.hink,beseeHyou;8ll,eiselyttmoment,uyea mbeЀou8jXs∨.

TXques#asu0 sYgla)nupaSds!b` seting.veHDissoluOflia1Q!+exPs迚`vJo!epwasecurEzfApxSppLwhisucHsuhYڠmanѕ9wHQsocQfܱp>ϵe8ཹQuQwtookzYel*LHr̭g, 1transfIPh#9y2{popularlib8lxhi nanqud.”؇*5cxvalu'g((3a|)hti-judi,EbFbk,PthcϫinfسexercibPbxhPclergH' s li0ⷽstonehinksnolitics,utestingponerydasissounded theenerallyxcellentndevot8workhichyyoirarishes'?hremaintoeroved.σSoxriderepgfection,itjtrangeunnatuPddfromirmham. Mr.ladsZhimselfnokillseatteranotay(pinIbefoyouraj y bablFult.

NolrZqmkeenlБnJd`sonywerful lɓyves;liveliavgreatuggle.Xeavi moHt0ack!Bri1opnowublic8studious(si.řڗdؕ:Ha@ Danielebs,ep!.țrgu `菀le!ldy爘0yd0p`@actoldƞJAhalanxQdoubكl Hrzkdo`,'slО0(QAartIf89ehors:s⎰road;voi!c@"thr0ʊĖ*rZEng81ppealindHdual,AponsibibHCsen[juyLs*op+sympathy⥋[pg 343] H>Atdinburgh!nos8hzscribssupply!aXhrȺ4m1@ дxbodyOYdsomebp$sIatpiH9xrx((!th[[pg 344]a/>p dstX2)ڄCauriоdmonici0bt:>Leb(showouhaveoteennactihere.former.P. attendedyeetingheusicallalsoLe OOHXrrarInJ1bepn.9o mxstantXPpupshipȁmdo(odu,hdevreIyheseoricalrusadese2P!opP08ffice,iaphorhminiـcrjddressys sid coencyn@pcaacioa8frankexrhomalml,r.ladstonhr`:studyesubjihul1inii1rHbibbod1235Y196storieЁ 51a31 d iNfe74YParnrec1Dength.ɫPd'!IhlicWj390280ifav`;aohjx110.Ϛٟ H0hPȵipe8bsoluX.mpaPmemEsaiaIacquyJuly 7),hateaslmostorryeoriesadotlayedboldamendoughtndepe(ntlyf"dissiiberals. ButIn,

EnglQYreturnHopponhseolicyD[pg 346]a/>proportЈrworalogaini8fxnds;Scotap@vȃhreQ,albyic,jIreZour.pherwarningixْak{tlrrHritQ1,344,000seceders 397ٔ?04 00.Ԅe e!contestЀPstituenc|mpdyP761hʅcȖ1bi.ÃimagndurprisP{puHaiIelechsviewf(heev0so peculia C,bՃ2auwb(wept 1 x`xvexplosna anggusAcer9norrevocable diPiishjhtman#phc,voZ9AtomU(figurecoerc!lohdrgne(ftdZnticcircumstaK irPti tpy,i9we`tr o䇐uc0wiptm Z rxdefxsMr.ladstl`abذhop idifaPcipowh esiyee3wxw /divH3h3>VIPughkaЩ) dFlifȾhGM`movpiٿ@mittmHoᔹhirule.˼cluzQimHiaghи unanimXss`Irj)8fP 83.turn2a`0ٞIrq(Ju19):Youyhap(a Rۑ1ecuȷ%ian]inks0clYyaxsB`tweѤ`.ș`o"heng00wjudgѼQcȻ❃whyarnneinunsel.5,;ursanxi0hopAoaxmOuwyPBps1AiPt0nxBlettǤ89aAAnH9bkarituixfacpѵs9Y9eEWW28trax ^ЈIelec"Ba genc8v)ؚ!cy.׳<`obr"arppۢutumnQZJanuttackpgiq orm߼ oluؼRxĬٱyLrovѕپ8sugAlefltogehr YBPerտandouldetnceovedXheddress,uchsustpyoalloubtommahwholeftories aargeart,fot,eliberaissenti s.nlye urs(possib0for:defeatministery igned.

Onu30,r.ladst!hadisinHaud(lQueenzwhixirot0Pmemor umllowing:divConvati(with,ug2, 1886Ղ Tc/nmylos Fridaya u(y,@engard؏probala@worsreXf(fty-fiveearspolitic0lif(gooduȁaury'servirend orn fЈ''#h"spirits;nP8togeprleasant.ӍadH.skyw8we\ +[pg 348] a/b(q1ki8m0a dbouؕoly,ɜink,jremarkthIhrequirxIqemc9Ջ01874@aifeltIgh0ck8dpopport;hrd0sany1g}so-.ȍ!opons@P"bAHiouspwarped9spectscrupulxvo4 eppas`ȔclaimߕHemB Xe(oib9wa:evhfapreljPpublicrs. sed3|clusZarg@Haap8`Ynhalfhige+lroys@IgPuiH`uitJtiBittPsubjxٵIZttl(z bacX1ob@͕ٜQcircumstik :)un=(nygЫpo ground⹁K,➈ؒߟ݂rplanԐ rriTHiun"PcxpfromHy@AlsoamPwexs/te`olu ready:`wx#dut`sgqnҢjbȵ Zvma@rivial:quԠ wo9Brocs)n؊<

AsrotettiR.Ȁutton (JuP2),nechoicepis9qagP+[pg 350]a/؁heQ="4em;hr|_////Ҏch1|Book. 1886-1892CtI.ԙ@MorrowqDef. (|87)2#Xiea@n(g,nlargmiP2aaircum̘;capacn8Pinfinite;bygralreoОȒXall,Jnis`aXctiembrax9gRworld.vapark0ʣȝ(8deaYPeedbdmira);1limpHm0tesbehavicؠ0muesteem8e1m!ccoxisЧadorA .BowPd3ggI3;firejqIrpolicsumm,r.ladsPaXeri;six8sЮȮi0liffnew liamenS(ngdpc,y nZspPsquhlatoryKpsc@moxlibsYwYwi betwexiysec@cȐHnsXdеal+aln`v@coerc!wassshrRext" pl!sٍ+legisymXiyPq`HXuRIx1fashѝ*prick‡ci Pyrsv``whoR،+i.00m19haxwosavanHfromhlh 雰n `f!bop!un)0is13DurʖwY8mohtryI e BiyRQs19fY@jnYctghonْ`weؒ)uxR3510ǶO="-Ategsee'IlinvewouӍ"8an,hakep>Tٳee-occupͥ9P@`uggl`idoАh8k Xai hXtXntayeaselesxviȟXXYijito؄s.΄0e!nowxhQPuwhiL0dy mmitfdec,ilowHduHrحAbc!jor"ssyhp,i"pub؊Ҩ,dilit,ratchfuudchurch0opx8H  dehtQꈱsetbexa>emIȲ8ry"Pig78b:duc AÖC`)Mɷwors`IabQZtiwr:Cert8Ƚiɼha=Ik0Yyaobj@pursuPr84䎑dX!oS[ad1

Afterheefeatnhichisremendousaboursadomot ed, adewayoPwaHomstongenialtphereلIworlxcompanyfllirndcton,enseBavaria. ,ug. 28, 1886vJWeuȒ?rgarden.ԓhnlifquixuad.ș(`stitudoesotpPPlligivhe⛈Pt0l n,utȜsayYmuchst0v )myfts;E!ciA(ty-snhFebru))adifficultypgouplldeafnes鄸ncsma lyk*8anar؜`XepsaRangppo plkYge ڌiiseblishRԧitЙlIrelե$PrehensѣmshhHrejudiZtexc*xٍpamphlet,pos=0001374180 id="f_213"tX6a5!Iknow#I􋉯Zahinkf*NornP*r)9sixbkfȩlͧX f'"said!54nWXrZwcuriIay;raca㌠z.Шaxcapabilwoqa8poPicpview!p( I()m,c8ZripPsteeǧge4ǧe5g5gp>A٦ٷLagRo賨ticYrouAc(8cɶXwtbsignjsPsymppiѾud0fIAy tb (Sep21)i:o2wifeHaQen: BoptmayȀ0kournkto [pg 353]/d&Lщ҃R:acppyCRzH1ohgbgXt plntcan cЏd f`HIq,owP9ffaiH|s0langu9pok`gu`hfaXia9lPsпQSlavonILa.ntu{pѵ`f_y>hxhoPX-_pbopsrd0(u(youG@LiJ sXLk( 0utA/9b so[ѐseK0'fuhH'@lund8iPa0llɹ>@aduyl@*ѵemb(20qYbackH*CBAnaelief (Ired)hP9`pg¿zre9,dhрe Iliad[Isummat`em`up0j3PaHhc@쩘hR8ack3now,+ аXlќїSxsccᦩown+tPeФe)npaJpracItXghJevils)8g@irR=`niva, honwiЎ蚀rebel/-rpeag+AsЩ@; n)W)itєaūro(roaXm@PwIyxg1unquQbىX/

HAɧy_n"r+h8ѭzaircleagpvidu`ghAlAopisعurv@tesᖹa숰@fʡho0Quad9XsoX(iculR0X{mعA(lHachihRr!atФH뵟buiHaneP`bn@Yfa,), d@.̀ Glads0we0MSpPssɹ!3aParsD(sЇRus8Ic`*mplac2edustrilis cHpmb(keJ;ntsl(,գ@osalxpalsie4amyYgloys_crKcӷicKȫZr0hu1depiRoe؅١nZsombi@ BciumphBnspirжfػ0v0cui`tyti8ᶳ؍l1ayBjunwht.Obi q89diary:cDec. 29, 1886T«1ppexKP Scoxsay,EkoriIpleasan_^O8Ipitutelegrap,y򾑋tavpzo-amu@exceeply.Ž邨sha8ofG1[pg 355]>/maeYvy.Ծ gbemIbegunmihqpv؂9m¿xun.Ϛza؟Poc).ɿB hI;yڽkAᩰ𢖳'bbracn( рit,stsoreadingante.tbeenearfhockndtrain@hin'omerogress;utрpaterbsorptionestshich,houghfoundlyuman`reuite8feinipld 0'sirectepara:passRiv@hDhhaveodhchance@n `creepfromrlpool,Ian!ab@auseˋ)sovidentthamyellow-me1ЈarticulYeemsosignedymThPHmydisturbed <:3ĊhillɆrri(omiddlsea.'=divIIIHawar0,a13, 1887_Q!ithupleasu Irour imؗChamberlHȑXrac0remarkableڕa x8ide(alPsJocxcommsayphIoxpoliall*Jostsiouzall`meeP rconscie)on8Й{moAXfscdabPR˂XloxbMr.madCeatirgw8pri0Pie(iJyo`rm; eŸ:o`tgood.arg(Pfin`ange",wouHrash>expt erhapsJrapiH(fav`.כoȒؐZager@g 0s,guzboophiesMnetnDpshength'ta )xim,Ptppl蠀emporaؗirituF t+xtnameѠ˭1maeZ resmret8ys29in*@pAIhIq,Pf@1`owelXouycipityownŷwpa1[pg 356]a/9Knownyumpet-bੰReaȼ f acc0tиsYfq( hudeǵǚdeaIddesle shockXsa@8xfuexcqqaQy!backblfib(neaJrtex0ضɮmdegHh`0Ysacrifihim] xndkJdg0ckcepq,e`tiPinf8dom(ȍp!@, admiri.be t@ugg vpoȐ#tiܽursuiXIȒdo#ve讌sucZ.ӯirudOlympirehȎ8ak pPpadPby!Marm3Phid+Hmos(urioxexogcWiam3NorggHookedalzڼm!AȠkʜɤqڿdepl0sj!bdecs蟰my;selffairwhhngulaZ(nkheal0thggPңPuHpevX8Qunrڥx(km dischar`(asYC0VdCear1onglölong ytww8Q/divAe`onths蹨)кultiXex@¥(ism 0roseripjttracspXt.Robertlsmere$ hwoettersromЌSysuchhlikpp8onafru Ink,whatsBcPArnoldism

To̐cton.O>Aslin,r,as(a،t, '88&Iؕqч薲loiXelapI٘"ercpsevenoug@sea Hroachei(b)backChontry.םpex@uldsanas;InowpearXrh upmosiw9,fmi Jaort`teauࠨaktumb9x2n>YhȗIheofm,0IѡKuryms(slowyublicyice5fa(twШRl Painary;ځ*abѥQefJqq`َ ,ixfP;ٟno퐀opɣ蒨nThucydPTҤ,.|wriHa s8|Ch`tianity`@:@S aTlo lȘunQqbeyo~m@rĴ)diumZгHZaacrEthȖБsuffici substCnup>qualitiesgiftrJѧPctqt ess3al钀conceiva!excA.ȱ2ds0 inergempcarewolJkpQsaLh (f龘ntȄsshly2h normf@ (XSalvatiArmy)`2Ki(e !Zukunf繏HcȾXsHx def(i2[pos(nкpt8WQI:bealxy8sirelX1ȷaiul@ptmileDlsugg"ex)xgru⯘agpeci yx sȉmWQ[pg 358]%a/'@wYus!byZhelpؖdog3t㲞+o뿉whe񂂾bnk0iowr{iAdw݃벁tؼ,鐲(aѿuAdeٺpa;̱regQ )@`ulCpQs cdvancifprhr`ɷarмnXHataٵ@mlac0Prov8NXTRmuph{Heʽrغ`mXr:o ؑw!?-cap80tuuHn>إyremark$eff)` Q󐡓фCducBpusoog3DuSrYiHfoȿ`ckedyҠiwy= imhgncitadXbelief)GodWWn>K(3r©book00eeJOZang0cannotҨ` l-b(.toshဈoubtsoritingpont.

Oxf,pril 8, '88nImrateful xourostnteresZleth,hichontainseryaluablearns.nhe(ridespiedatavPten @twofposaisbybbook.ȁIaidPouxAcademy?spoklyfircentury.ouef (apparly)bout 250 a.dusimhfHeproHss?‚ I s0ish;hd9Qsus Chrianlergy8omeOatempWSt.yXan,solender.Xnor,doesBeugm nspeponstane'n siow one-tpopulat`?r0T.rnoldy`erday e.#Wa ha8e@summdnd pm2Xee HthheveaH!Zs rhasxroAy فpep0h(do鐎emTrepatt8iH?>af@hmyindnAPoshvHmouɖ@aᕠ`(al4irjdropp5humtri Qview;>plusdžØhigh ec(\onqualh(fri R[pg 359]a/ϧϧϨDollHill,͒13rئRAextre-Jsaltitu,xI*usartiYR.lsm聀ჁҊAdeyuriaknow f`ou8caro)pڝx,j0 i)bНbliquexpஈIaD MaryyPaalyhLondɖqm8tak@oxѴlPgƴpmyselfxfeظșw(2?)ZpackYEnglawТg 7XIp0rbfi8fromledgரzYampnyضTq.=sgrall(ڬqs eеPbwiȻ!)difficػ:import؂c8scxt:ligioxologicargum0@especcosmogonhndϺgeʜScripx, k0n\SPmQbKd,0bookP`prexlk(1>eAssyȈixg:eexoc(tif!accr1subc8roducsimi9aqZmfe Mosaic;xddthrifart@Xx8ainhe(ns(c0Tٙj7chapDi(rx:Ren0()Hxhibmarvell9iP(!)Jews*unbrose0"2hys±erzyy ubmhbecauseq¼ 4a`(bqģQc HI؂%do:IscepPnmmQQg (ioa"supe)HrٯaPu*miraٷunsuinCex4yasshJdabXgd,؈ncons faqNewԼaCQT0iav`qun=emPs@ذ <:potoiling. Iwnhatoureasonsorennglandidappearoeog,uttouldmpertin؁Rakeyselfudgefem.herst)asƃnameem,ani$date.„Iuassuar m; surelyianowfar.mooȈhs,wa;skiboFrenchvelpa8bjecpnhi؂qe臸銰beenuiteccao@lurhlight/div"Acton'settersArepmayPvnvinced͆Gladswdepth s prentrrs((had0rd soundedadAaria^mKmock0fromprofess(chool Ssunbelief,cp!inndˉJ,ȏaphhatholicee3fPaclnlRobplsmPMKed, r,{tud*vtorkhledeepetragazeParna`idrisopoiPtd|,{dangerousxlefllguЁVlacknicety9definon0widse؛xnR؜0؜GA1adxish(oexcspmoralcChriayHN"se`moepYanci!ansph"pologan᧘1ee*fficultieʨira;O(eapHndy{ou;weNewmch򯘁y:ȇmƘآAc,Bbm఑nЍif*gotaom LeibzPaleyrxu`iHegeHaelCeijpa9orf8sPYinsؖxoa8ays}3]赐XxӒQHub c ctipig;s goIȬ`uhilosoph*ŹroccbnvaluPervR@Ofeela-ſZsociGʱwbe(2ecȮrejh#㣂/;܍titukxiLsismi"ɢngnsurHwnrai'tre$easX`söecse.ɻ[>pTorرPa(uqn!Jeaا0pucx wro9os騰r[idi.ӫmJsaatԨdot˯(ppcipINؐutcog`9ʴ٪ctdemocracػDgetc؋extIar,J Hzi虐9𶨽byy8p chseem!gnuХ8cȝimsrIqP`doubtAe\aa 'IآHȷ rgؗ~lyalepos=0001375128 id="f_218"dXaހ?I62 ="4em


˨mbp:pPbkxh2ChapterI.helpnativeolicynct. (1886-(8)
asf9youleemyЂphraЉ(int,…-areastatslapyrenceffertX.7Johanwift.6 ; 09ministsucceededr.ltoni,ӍpMichaelickseachrtookPsecoioffiЉishretarXwhiLordҔolphhurcl(zla exchequ`s0ГHouse#newpwȔXn@det`hXuXpsoldisputownoonlighp nerry;НroyalmisszCowȓ!qui*‘؜:p;noמoun'spxirescestwrs`w-eblways!marz.KinduieKnptterChadd0portalue⒱8us2agpearexOnebeXarO0WWU:2-3l(stЌhardyet0rHhlxdfulpeap9bpk d昸;ru(f(armsAp`tealxpX[n@cabipLremo@AsigleȗHm(nsibibBIsquadrfe-guc*ppobLpslump"A @@exercisPprpɳ!8roCzIattitc[pg 363]ea/y="-DyPosiɽgIn3ՙ8am,jeclshparlia þfouylgaxt.יav٨howuخ8troHsrIXgsĊjˌwabou BPeepټHs0s.s`xexityдо*b)did grwqupض3gna. Harry)z@a@ly:H翑Augp 2,fI pppreciо"f@XmpQyȫdhaHydiulHsɸcr.ɬ@ls8xI(inkɀf0iɹAa)i0nXced,kr;ȺdcZ 8mfraiXedI nզ!ibur"0mmbarrassKchoichples/ymbolICnxacpaPیpo8view;ءQȈane `judg s)maʬPans( inxry.Ɓ10tẘnлp,Hb= amic ՑhIQy0 unA|DBy`9ߨrQʕqicip.Zt dcюHinvdxypm8inc٧PKʪa ؖ`c:mu[pg 364]XciplpYhado8sh!s!RpartHies,JIdrawLord҈`olphhurchicreatxbound serturbtahosexquiomentsnhichcpholiticiansnjoe8effsensՁ8d%worhc.ŊAthseemssi.Ht(qsummdromho%MedrXean,utbPemadulouavastl(ntconvulstookis@OnjreXe0dSalisbury'fHmak葠forXm he gon.ԀPhxzight`van1schoolbamb0oWWxiHairs(onowo^aroupheXbalaH,dsuvocircumPfambtid:)Xu/a p>

Ae2ladneP!@usviewIituX:div"Hrde8ChrPmpDay,j.݆ZBetweWservaPloocgulrz屰y [pg 365]a/dinPHI8rk@-vjus1-_p.m%aitmye6emarecas//*ɼ@sоmxsiQJonrecedX3Qthinknb002d eof`Ymhdecla꼈behalfeom8(whiGBmRrbcos@Salisbu8particmayؔцHhH@duca`ؾzero. 4PanaI)nhx̐}holpicke`Щr ۟Brchamp?lbq aIʍregp punenဈsehenimedtagnifyingurstimates.

or6From㖩alreadyassxbetwyyouɨp8萚Puaـڤdeclarʛ9desi)yhonabl6*ccili s0hUnuĬHafactgЮ .Ȩgaa(aloquammeű0poXȭgooJoeumeА[say)w)bl isAyePpWIasZ]Rcareful)*9OQx6YJmomakQc@(IifirȰ8Зko0n1i0ihٜsh3rlq`0ؙֆRolp * aav8is껡xminimis02n@iI1WQisoloJe !mxhmطWcliϓΨȽstrsuppotp"genɔlicyy(1pa aboroafturn.>xyǵý,2sosc8mo9UanȢ``tsarPڵ@0xRnobod7Γl Ijoi Amay1YffairPleffeдhss'߫>AXppy踈tmsHH񸈼iR rsǮ/divMGladsxyRԪ٪@ssx,JarhЯedd00littSpoponferencXёsfrP.LoneP8,pr nQtاṠpreurWhinegotYQgpЪi ёuHst8,uh8iikeep8watmЍm@Rdut1@iIpruthfቀ1grQ2 [pg 367]a/Ԑ fosize="-1">eÌ

T s K ndableori(wentmoot enQ.r.Âberlainradualdv!hwholengtHeublicPcommitt@himselexpediency9esisqkiHlegislau!ity XDnQaccordwithGladstone'srinciple@aefereQhiswn (dlann0efanada. s followup,lso,XadmissiZhcoursIrustPԑporganiirJЏXxecugnm , er iXpacaigoXt׌`xst ahWhiteh,Xwe@ X@shapzyghinkoper.Xossə"ucffair@xarliaade`dist`*nsponsiai؝:ccephxcredPsubjectAerecyiousXruffled.anguagP`usВ<nipntiariYwhiHeapsidҠXnx(dXzcinegoqrivp.ta8yajroviialul!Y`eewq,y`apped t HsBaptWT568WS2W2W>QHromǧ,)tbdy896Wel(churc8buarJcScotcrof`EngQ,[pg 368]6/>Pb(yi-twollHZpeogoom-needed,hȶreX}wloya(8nHsix賘Yme9wouladuoѲinivx䵊eAe`8reQpocrece0͕CaȘvo@k bstrucCbusy0鬡demPanṫsk eQu cuy(@TJBattac0gJ!emp:faXgysG!supkPPshncabty.iewuXcharPSHt,sSW.arر3ImIѹ"w@pdmnowhs8fAhPsunexp𾰏aanȅXPym83sumpڨy9munqЭ{XrwIhfuhad;ʳ ÆXX8unw颢pshgroi`nthgC`losa tii)sѓr`mo+J˨,,quiЅC=ا(r`9ڝ#iseaX.p>

peYhIмhRweek1gb`nZڗQIreړڥ؋:e.?=700?;3?3?>Σpseriou0mma(8e(Hq:lihonshڟsies.ףz8oPiceerccfd`1re-ںhkPnewHX1.ʴ bbnʺ18866]b!gQnBmar(piX.{/div3h3tIID (Aug17,B)Parneto8ӠȀ)sxpY Ji@tokeeЪzڽ8sgX {?ng;g xо`b On`9ad횀adepisindhatrinterestsouldestervexyuietZ.orneingenewdisturbancefollowccoercion,(aoftenaiofhursetroHualwayPe run!day,ittles"victoryght9worth{ano8rapprehend׆ԂfrIaPʈ9poicallieGrehBritaidroycombinatwhichhado@xouslyuilt(.Ԏ9wnooantleme@wit(im.ȈXesirPdefinitePnageov#sh}%argnGIgrarianb9two xthreHe0proposalbeforeȇe+Xyducaeysefill.ɕrXtframedqruit human urePIrishany ,o(bɘ Hah28beAiCconsidd.

T0goldecrhgrnPĄXbegtryIPsibposreٞ#jMParneP:8Sed,8steseekwhewZ@TfurnHasn1nci"t soa%row0uTۊCaoudhper@upt# 1881@sivQH@h-bpapur(=ɕxڗhX)HHl瞀nd,enerxuc"judici@.׭pe@ijSir͡aelickseach,ɮnҏel! c@`lackmail.XF*!odZff ndlorHIf 0Hay깘fullx90#ٿamm0ed|(8ʳsomers;whom=dfZڤJuraeuggleGF249GC5G5G>Psuc膫hituѯunlawpiraPnordoubtsyдXc؁bc75 )ad_Ylike p\isby^APar@ӾI{lgav(hopȤ[e8rr:div"CDec. 7,6Xloob"!orn.ȝsKI֟eX{pubř oxyoueyn,wзU!ourIviewS8paAiИ8nngʈWhslbad;qalmopRxiuges;xbeItakxpart8t0Y ؏nx`Prstoo ixpoi˧ata8cI)Xnt ړiaPib1XexLmb)sjdifiab(whUsequieЧshibc_obegudrawwayh(x`miseTialgq9PHؕhetbȵnew0Psaxkhx9husual,ۢhHer2hlieZ똃)i m cبƾAviolispeeؖD~em 12wwvm walongpye׍ ڙdƥ. Wlr1 dis:`rovaљԿH\dro̾vntalmedsuchAcoulde.oXhimhathaxeardromr.ladstone,ndKhe4notossiblyhow yeranceorllegalities.

TisppPntsi9lgaenou)txplanfxmpaignbcumselffiauthors,Xbexpected.heyadmostit. <[pg 371]]a/|qPOfÄInpHmcPQۉs th'll,rotme:HaweDmp 8, 1886)r@dour yl tyб tmakyUxъذ am粘fie qe likneutd,opXctuЛIжreyCba0Oi. 2.Ido⸨presfeelZг`H(Xappakuvohc3eHohX1Church,Pm1ti!nthusi8ic`er&ale=0001376361 id="8f_226"Xa<3. I@Qdmukepxaslen @hndliYWdplorXbwn:doPtebȕ 4pA.aAhasu . 5.pHl8pese:?usQڮh%~rahX disavowalQndiciafig(sgH2ٰpprd/1 A qHe (Sc16j7)O[h#[pg 372]/>iyd%Newc`le:Y1 noubt,sYo0nIh`bAȌpeop!dutpolicyQm(Iper,zhinhif8so0Bx.Lϣ,e id,pdevi)TH1ncк9XllaЮaivi2rYekns2ahڼsulmin)y@p̝Ricul,־8blab@(Im(Җdiffaacqua8z9)o`uȆ10-bs@Ɨwpemptuo`uszy5wraHIʉȻsse'%502'#7'7'>hpworlooRatqCowp Coms nebrua`,p Rubo xir3`occurrPw`ombinazrow`rVbepfa8it0qiXstXc(xlbank ZZcircummӍyimsi.?=610?;8?8?>emark hй`AgiqSir(ds`Hou8spl0AodifyingndedressytherievancefntseastilligherPanzpeoplexpay. Youavxoterygnorantoor,lawhouldookftBem,nsteadwhichtsnlyred.ÀX/a>hisHexact`whatr.arneysaid.ɈHouseKonmid pHle(m;relydmittPca1orueoneRGeneralullwrhageُ$d!imsib(ften8s9ydemed;re퐨Xsixoguesmoӎ@butopinio#grerumbmnearfami@.7953030>ruthlhvictslloweTsam(cȇىXcelsewiClord4wiHirps,rcourZbouxbxpolihInohoqIack[pg 373]/p> Mri8Vaca$egeQ!comPt mXlpdcthroughbar؊ra89Inon-logicwaliti@tIrishymfirs igccaxlector*Grit8.ud Q08campa@Ir8rhEngScotk 2cid" ocYsgglamajoy#s ute0suXe,exЀЯuJu,JanymmodH voluntari8madyo,qdecr𧑯Snd-MNoxrm߫ҙ(crP.#p>SowhparJaffa syttmotؖUnlike'llJyliXdesimaxg`fficult.Ϩ)- wgɒ!penRSFpH(hҴaldywn( Xoth,XpȻ|8influeIPcerroIGacPb(ThurP.Ҕsprٹ`oubwX(fromschiefDإJszfa.LWfHlc8piracy(w,ºLur٦Жhrөnc arli np.So)tu8HuptQComs!felmsel(Mtr[re񫰃ȿrH"hjudiiѩcЋMycircumfarm'uth`toЌ'PrpIautumxy(ٰᏌ!sb0isӱ%kPnPary,8c2⛩cab8prapi@دq,2stigmP!!blxlOd@Mar1887t^xᯜintroHmubЗ 9Pydispu𼫰ciWSrepȰd.̿qh"admitBhkhҼmbsolem8m2~HjsasĥYQypQe[pg 374]
ѷabxwhi+p(%opa)pi;ܿbONAŽw|IvitZosaharhabeeHwȩ X)laHae@?ÀX=/a>ȟowe٧䲈rfᯧcaiyf(eЇ^layourxeoheootfbfabricqcivilisedociety.efor؃billasntroduced,r.alf ,hoadonvIrishxficenetiremenBSir.ȂHeach:montarch,roclaimlanguageven` fervithattould(ollyndadnessQbreakselemnバracts.708433p>

For[mat0$Atrsttoodctltiosuhighoctri8this,asmclohdᆸurpippoweoaryyPxingmiutst debt,sp8payov`a[eudm0tnkt.ԍ,`tleapawfX Ў2uyϙ>April.nyJgn:acceptz@XalC sh8settlsumu1pplicareliefbuƋȍ`sonabrљ8myis.PyȎiainis@s፸ʐ@yd8bR,unddenP@ PtenrUlق{beginnjorow{Jup/Idrew,rnow-lordXɚytXJuy ogeȠtopm iallo8unusꤡafYAupëaenerrevisXicireeears.o@񔙝0`㖫0, [pg 375]n/divSularpPs+laia[Qd,i"@ardur(,ameli App(rau@ombXaة idL.Κowtecameisiblehat(isasistake,ndinefaultfffectiveonciliation,percP:theevita!alternHve.o1happened.

Tgov@mentgaunlockeI0xrmourybroughu1eell-wornngs. newrimesillmostarticularsollowloldct,ȉhtXonrwoeriousxtens8s,pcluding`clausfwardsrod,ga8tozcrownhoicasxmurdercer1r gravatnc{carry 1prisIIcountry Englhimhforiddlesex eω0Baileyaunyma9Hsugges1769,brAmcanebel (iaʅ]unalumbPtutfˌHen VIII;rtlinnota h`thbermanylawIre1낁itas(Xo00C inHhwheš8execuleapos=0001377317 id="noef_235">Xxs(cXyьkihaeenpozoee`gy;ɣmadqn"inu.rin٤acedup) BimpaCIbrhivilulԚTlwww>elxnttnnQshiftpdx0o-dajKmor8discre).@oucrc2,8tIh(n8er.ardid:ena @nÕo y7aYǃUhoɈso666>er`sadiqhemhzɳfXevh2miَkx|z[pg ]a/I)divNGI6ddeodu)irtP*pHcloyuҝ`carri((Ju`10)(olhc0 o'Hweekcomtet'ցsHioʹ%nxsXremaisJypJ!oPdCrbatKrkabp8Ș ax t(ihCromwyColДطhSh!peeႂl]phrbdutțh؅hsi@Ыxesڌ3uIefficiHoʫp emla(s'hȺrtifyYfifyhrjP˜1AyeapaйworkvҴ@0Bag(12w20i)p !ggooXr,ceedesignn(hapsor(h`cyajcturɲsixLlpr,GladXnhPd0un9ifHr)wq9hrɍfla l0"daHbulplialIomB@onlccobet@twxdqoNonitÀXclhAt. ѡsomeɬp1f(ihQ㭫:an tr(.pY Yhon`W8Ccowaevesnвq.קػڬ=c8brJQfti`earfheeignmQueen,ndatight'susinessasstrangeRunforesoal whichourneyalittleXn;ameeriodix[pg 378]longh,emocraticoad broucommonalt kalm `ce 1832.provision!entnto:billithoutyiscus(Zee oseiviIrishxecutiv)oxQstampiassoci؋xunlawful;d ipeXluriescЎpla`ar@%fy vausmportacondittachL(clams,DlayqfoundۓActׅuleedureePXspe.ԕJextepPwABurkallaccursedli( p(1takpthrsȍ8rovernm mXd (June 30)ius0l9rays.ogr,hXnoeded;Prft1mozIcarberaГdrewromHד tookmselvЖ IVm/X

InelbXnow(gȥPtminisɝzx8idgicq pffPdeear,acauاxtHfaxouldb1 -natHdf͓Bal.Hi0Ykscepal,exha8iblyrti`ЕcXobje{tafdsenludic@spqute;emr 1Ц3, ida+byHa e0alevol*`@hH!cdmion., ѳ_Yoiad li(XكmP߰pwea ʉiXdt1hi讨qѡoɚgXnd.ȶadiɪhnHmix᠀ar(ksofpeXheadihbpipo aarguBp{(ubtۋȽdvҽm@cas#spir!awsomeifstra.nluckeaszRlʏ@)௉be0hedqtyru@tos30K or*in`p؏BmidabyaXyKbetld HymXs[pg 379]a/@ᩏ-FiuCH ?;p>"id9fP0b;aFoLӻc0o.ϸ3oRlPw!ƽɬgav[ugga7taH)lexy8coerpn׽Yma(Xto. "0c Ha踑8t!X7Y9engwtXaityBh8`,Rfo9yrpHīAHX"delighrdasToliPayp>`(aimporRnoveltQ`ong:\!m`aXommЊoanaY@pgsellikpeo NF.ÄZ8flamyssuwhhaporawakes.Gladstٱ2roclaychoݠciȼ!PwouphƺdH 0I8Wcy`wo¬xqi ةir󍑽 exibodyAneuplຘEanxieȆhpnga uT0ʖpaign0Nfor ireprvivihg0ngjnowXs.")vis @roope)bbackoȄapalStcfs"folk hiupirroPid0jX2moelskev|andorheirstimenlluristoryyotearingiramentableale.onglishudiencestas newinterestqЄ1narrativef fric@explorer pa0vigaȅYPacific.υIrinstrucsven0ojcuriousonclusio9atdiynPonal !mat(mu(beevised,BڇPr"tharmo|Xn3.in0eriPspeakers, 88x,iligPlyoXachacyhover-col9 apl<-d0ajh8erWy?mrydid lookslumbjypop [pg 380]pricraft.uٔsffatooapm,tro`har9Y3ph)iasand8vici8QAwliyri2805+8З9(e-halfߎb81ightsDsrouldbe8guadxuryKtidcommpulfeeliBi(sjabo|bineAublicee1frequbari"jPdign.Ùeat,lowPSрm+er8impxrsPadˣYw Rla=ybe+ecȦ+ç)Scotcr .ťy(b(shx mo@9n 8:udd 襐ЦQ 1886܏|s0grPʬ율hap(itfbMGladnel3s91-sh0hCncx.

Vm/P

qproceeun cep4lawtm %cȇq͛|unAfo iPcbtwiHwith usuxercc0facultbXalwaysX effesHntr贰tw Bsq8,qiciYow(Hwh³gpBoplɓPse*ʣJcPntan2aCrimPAcc\gѻqjhorr(;OIfi!AEsomixȴzassemb9(argKhiel`wjFCork.ɜaoo@ll؋rf_Y'sbitс*eg¬YSoldompț do#A@fitٻ 轚aȅӍПRmbwnca`aHworᝐirma ak9fcaZ duxflatPm0pȺsʏɍNe墈avour;h roug8tHr٦S[pg 381]a/(ɧom-h/wnǧésp>crowdgXrne-tH(Wh2yfchooimodjap achSZearrV(;x5grr9o󋜺 upgan;恁haskc8

Threaysat2ffrahbrought0e"Housommx.o cou0sZvaripsducъsistan"euirusti@`H\bloodsheȉtsi9utmosoubȉedrigoYquiry.r.alfourroncin!emptorydgmentˋgad YprevFriDial|,蕠vhrapidp,dnHhavacimntilzpnihSx9HisXkCast;yunitМe@ir7y)ss-examino;Xsp,rpecFC@B{Cher1eleYase.es@ngth3[pg 382] Xdraw0uPftX/a>"ntstcxqsw8ow2nlle;hea`"(#̈́ŮLf@ hu`gyhwAahargmuX (di{NGaaޫdeB(sx߳[)ai8cHner'cUhePduկ[cee!\xppٷ¾Tɕ19!HXZqL selrfepʫ(rjursom01tePBЛretuqᄀwilfuga9hieffsh* sȼȕQwardsua (Februa10, 1888) QuxbhvgȠ petrregulaY.bod(doubc׃Дì;Qm ⰀٕXxacde[stuXBpAicungl@Rir`c(thhgwdoб0ѕLp0slknzggQbrokтasonyЊ3pubXCsp .Ÿsup{goPnit.ɿ!killnPsm Exrcot1,hcٯ dAu(Ѵ`1suaąȚ눧,dihoi[pg 383]/ divIXr!iFRЌss echȸzmain theousendutft;embersenveroitchelstownmeasureistances,alculatglfi0imaginaryif؃}!barrackindow;llort( orifco thowenv0ed,ographsdiapmDtaken.ome 8dpolicoeustifiYo؈Emwhollyn^.‰witha dicialquiry,uch`ad(enupcaBelfast1886Ј(doingtfutile.ԍgnm!remainedtubborHslaughtTthreenfleftAiw!?dogs.oS(cidjfrisdminratiotirrdeepxfeelgለIrelXmivign{E.

Hi,aorkeyinewy.ŖycfȍdefendIhcon`bloucapex(iUerrzpxru harshseitechnih@m1`tic/div(3h3>VIci@Unwisɨsrd{詀r@cÀipesngmyigȐImopurupssu#faؘ;tena٫(im@f(fart𺸀tX 3dIfhesʐ`em,YwhaHkn ɯn`8rudakAas୨noPnlikɛ|famouea`00PaRoytwoundqirpys0fЈ auЧzHoS(xdtxbmm(ٍctMPa(Xspo9p);aquBfrom0tٯ0`y,Bpubbab(*a .<=0001378142 id="(f_240"̀Xa>ƠHymparlimeMH01ąJ чȒpflathixaتHpDsmpxbo0,Pce`comIzؘ]irdBclaeֿcircuQ)un upulYfoz73dpeopK,toP ܴSognxerhx14piu*HdicZByˊXolemnoirm[s'Ueix:BRfpqA (meetWhnixIkfɹRQnachh0ptrk,dicv@orjxxwaspc0hfoo)laceki1babxexcitepr蹬znڬowCack-,EgpjmPti#gu!i.Ŷxman@Un dtavoѯKbopsewZongm)h@FdsarڡbC, flockxponw'sp0ɵxnessbwHpan*alvHclweek Av giQXor zk[pg 385]]a/xdivLSyhamWHsoradeenromptepyheesireoeepcausenhichrelandastrugglingHYweakenintroductionfnyththatouldustlyroughtreaagainst.ԇupshotAerven↙Qacondemwscript aialaffecqwiCreal0dyisturbed;uCmayv oneome4o0e!sxtensYelsewh.

Amoe riesor 1887ِoccur:si+Sxr ham,an. 29Aargearty.e(8receivusual0licacHkindness.uversaPcfales.Qk,oharmhme`- k31߅Off1Mla.m'CambridgeDi!masThityhyoNewnXilds: pleased.awr@pwick.Ŗ(AsxiPK'ZGFebHaward5.30 eHoork pap.ƅshGille'sournalsO3_ZWr875FeHdestnu@߆7Rordhaftesbury'saMemoiraxccip0emarollisȉ ao9near׉sion 2himA@tim LAbe8en]hhumimid,nwЬ7opgawn 'g s`[sl].QuiXrte@ always;JwIembarras, IZ?Ɣ@@Hr,po,tc*x0XYIr@8s@s8ol񠘣redifficulˤsquHohHTHڈpoke 1-yrBcfu򹱧IУ8asupjB.oncl1mيІmϾzAprilPO C0lxigu,ѣou(madol.C. 4--8-10-2h yo didduXi"RfП'7l 2߲ۂQ`bu`t.҇u(YƋgxgHleto5y 4lispee)y0@Ґ!3upsubjecf pe&㾒[pg 386]a/Inu ()GladstostЙa itlmpaigou(qh!pka(osriumphaXeNty-Ȃ`redth avrowdsgwagЫY"asee!idouhonwstro(p!ntXy@B( or(x ypdnxX8 ecfmpju@๰ca(0el.ɉsot YpantrwhiXs0place.npItwanseaпeh(ab XaH;neanzqҐ:mxgo(nmRsPirlc0a8chirulA@ Bxg8noposiKs ldXCa52Irк0i`self-W̲Z()dj`3may le셚ἱt8experienwX㦉H8yameetiProviaǏbsugb0swei0pH86newula*~!xanp萑tohy0Xnguؾhad9Kki`pp(m y뚑xlCmxv@P1eظBpOfopeʗهi@hcloYo 0ybo``Backbealpn~#2,7GBOff!11.400uHtyX journeyowanseandingleton,here@ledt 7.30.alfozenpeechesnhay.mallartBdinner. 3.A <:3quietP-@Wroteraft!associationroad,odel.penforenoipettl@sdiscussifyeditats9mo-morrowithrȁxViviaLordberdareMStupehI{err BcliffMumbles{IaveomehsYwritreliminary؍auessde dma!hx10??.(adard Dguides. 4.MudyZ. 12-4-4`ishoc莈ixs!h:okZear.ēʕ8,ϔ[pg 387]a/dundrerrangserfect arl1or;orough`mosicultoweHIouldxp5.Church 11a.mϚY,IarmyxH.. (vic(ong)ga86-7ipgoo. +Wrprt,ڎXley,tcXalkphyg(eCX؊2quesIa8n-polca`dss???ncil?=;;qcpIiX6.Surveysঈnga*reedomoptown8br@sajealaffa`(suaimbutĝ` (xaktiAV-fi utwocca1-8Parkarmreautifulab0zymͣuriIchamPc¯{-.OA .15ba 01Londhust;YtNewpoworatpjkn8`ABlackole.ohto8inid=uo 3000$;boP ;xPbrieftǐXi 8iasmv,EȨHzٻA,.τCJedjfamil('!selvᡰTe6.2goqHAqCItAyxarog%n@traXSone/div0p> Dece 1887, 8adihysicBԾrta@ucta,JGlad٬qhfI ;w(slhЪȶ)Ȗ+`"nؼaHae)itJhthHfav@ymbsawIthocieX(beivatopdeh9rrprihimdisȓ)bIeAwl'j(rjXptRTrappi:sciplsilѠڢhP㎙voovˁsehPcpazzinibookantË@fde(:judljunrlr0鿸m1i`ɼBeugHCdu ganisme. usu@ret0omenwilHgِ᫰eeD0sCghIА(atЖ tenacitŠpicu9piՎYv*蓠mplgrimag2Birg (NȞ-8)"s[pg 388]a/>绺ɻliendPa@gperXro@آountqHYiyʻ0e: <:3Soaid8, ent 8rSoim͂wirelyiPgagedmidurnertedrank8ssualua(tyy besboЍ@ Xths.t*la@momi@tellusJohnunter'sonfirmation,romowedicobserv HremarkDo;Pbfow,hosenessxplainyfacɇ1Sro@ughtpm sis0nly:npdivα�j48j1; i8125r5B596k79627=14;F60vMikI96324˃ʆ 13ʁg*ailepos=0001378318 id="e@_242"ԀXVap eways(ofoaxRretHto`Lcp,uc`Rhircum+FHt` rmv`tkDufiRHwhichPowr,Qhacc໑Kao۹8nItanupvipoliciISedlȲak̘StuRHelcl򯫴II8ʿ#ږPooIqCs`(Kou(ٿtripMun1SPtͩiirBI˿hop|Hmu載climȽiger2t6 ! beenjoyemact`(myvocc@,2@Ҿle0ₙit.$90/` ight="4em"೹ChapqIIIKSpecCommi(1887-1890)X <3h3,IMr.ladstone'seaselessttentionoheanyhsfstruggleatasowjcreAhisublicife,:especiallyngaged Hw1remainsostmazingm.ish郐e possib)oaЀover,rrXin8aecondarPlace;uooloy (nectwithprogrɇIrpo(yPritopina〩cal,ndstillubjxerpsPYff!name.ransacibeounurpnalswrody牑nmyinidu ater2a،fuljoyevispinHf"spaakinË:deadli8aim{omnipocparli(abuvurfÎCmoruthpult. rook q irauZwhicincidbeganjtortuou.resCworkut?ƆB`[lXp8Illd`iainvolvpsexa`gravechargetribu G@tuabsoliehirit—opp8ntsmo%a(@t mno: ldfromex@ viewIapach,XSSommi1888 nd(ئugthxQma9Xisldu g^ury.IsIʇ7èuc"Times,i( Kh Dnoubt5,CshPr`br oldagKl@1Rupfxh:d8l٪alӭXef0t`2@o`u,gnuo#mbinۺxeusyRpiehoҲudhXaic.Љ itxvP8beca5Qub IziPsireTp>Odayݱ¿Yctak 2*PaœCoqbps)idabolsshoЮn(Alt)ʵIppebbew8PAasc7ٚsilw@ Mrnell.ɴdd "f!ur0Phnixkö rY[a(8ogy(myol٭ fe`,havѹ expediXpendemnɄoug8Rٹ1XԼ`qdef@.<le=0001378572 id="ؿhf_244"$Xa>Sgiv ضHۜPYque(unmZ۴v(rxxek]ٿllo¼IIncPrXa1 82ؽȶbXY2*y\b8;LHogniygggkiwork 9349 55>sific:dr˾,nowUbloodyȔ’8owpafet*qualifخm@humMꭁөicnou@+tQq392׾thryogter.˃Tcl( tlobbPhxhplacjuhYsp)Ձ.ŚpeopعwhpȸJn@(Chock(suposu lgvdepi@Pmanl8op@kp'pckŰTmm2LjgGG8.ȳ;eepsHd@cHful«i8:dudafabrٱȐdmitha)einisterial@sereotithoutomexcusefဈrtorincredulousaughXhichyeceivedisppudiation.ԁp8`irusto`s؂,po fulsponsible,ewspap@Dworld;reateourcehauXrityrun`rsalnow(NeglectnxosZȁHgainfraud0dgeryocumenoe ` purblasting0r`litic`opwould)culpa9xnoommHde@e.fsnpeopcanardlyAmVinkِenusines,BTimes

Th took;viewsenchagЖbyrx.זf--twyu@JblicЃ,eyPstorallHpornuendoy(ir1granted.Ȕ0rapidxrideomi`oba{#+9certty.ɓspeech,!۔ipit +waonAault,ordӠ)bule 1ҕЋ(e:<Whykleimh0MParnemurd dBurke.9du`Gladn@maa;risuhanq9hadmix8HmcaP advocѧissinjwk furp\You`yack,fai(Ьbegx!hBish褐n , dHhSPЭhoT,t2wi0nehisccep)a0onjrefpapXxQtiro@sumpcov t۱C[pg 393]\KX/a>ӥ8parspi0dѳson0s)kr@ngth:dP* bs@&Nowafpw`askh{Ed AhʻlibPbeHlawPs`simcaQ"havѰ;Loo1d8¶liff'Hwnac+hoPmre4e8/submit iddlxحhjudicpv0TLbodwX@xisa&almo(1uț`tu8@༘il0sissu`Cpex@haz2*dicyrlveP1I ?ɵPx@av}mightcYbe4 eonzD٣cun(,ׁfFBmoffa!up@EngPpinڍexYoP @ةQ rϐɄ2!0gҿBee8ڌ `ocuII2leȃst0>CbXȷb f`l`9Riedeforeordoleridgenuly 1888,ndheewspaperasepresent1y advocatehoappento0 principalawffichofcrown.ԁAlaintiff'sounselickout tassages,aiatili*onesonstendlibelled;cmdam.ȆhhhelJhavead`nndoubmaacie

2BАbatȓ̙@irrxlromusuЧPnesɂyormpde ksit IshakeԒQafסҫx(echcӯZriꇸݑPd ragrapȂ#YniithqannXcehRQbbЏ@ag0ɴج Tsܞ`(ow issuvou٦ăWwezJZ08is@[sp,afrqoss-exa;&yuev#ph@,H1b!dg+8g)ٲd(Rf a<gY<[pg 395]$div>SDHFxAommi(9C/鶰gequ !wIu8adjзmi 1麠sugxxt*mPٱ`o`DHous/.9mйA ofrig8; 궸rece0dwhr)o߶lo@8Hh[alpcibil oSmnx`ynhHcpurporyqselfax,oheȧ0rhevasb5n嬳쀟蹘cnpau$71SmAlef𼛛naFri(Ju6, 1888)Monl=Ӥҧ?o!ɵp!c{feeEngl9عYhid_Zҷobby(F~̤бRw )oo1𶿶strengI)po9KilIhamau\9ia?qg Php2xugvDju0murdʿbQdemoի=ctه`subj!coolly+gonRtcertrf w.Rdvantag-Юcinkrguilthcɿ(kee1/q?Ӵ[einowl t;wn1rs (;@aram pHdo0sk4gr𛗛inqu w)ycWs8ɻria`YShXplix׵bsoluteHompe)"eءchax`oxa`1ۿniрghtutnheaperRmotiforommittee,ndiThursdayema iqitsiscuss.

Wherrived,irecause"hoafkajorityasrresistiblfrom*olalculapolicy2simplyWpsitu[ omingntoleraaew0cihadhXtaken,qelf [pg 396]ar`rel9ascaltЇtosipate.HeovernmentetJIrisheadw(0refushfer ouldgbe8will)0propoconholmainQfudges,statutory@inquitallegscharHdxgmembersarliabydefe`nikrecacQ.ɒgxleIrel*preedaaccep,󌟊oncokfhowMoxi o brcb.[X5/a /BwordBGappeHp8tAfouimidnrstonx Rpؑ'XmJO8 b ecertalsdoz(s(1enor0:thisuddextewo palpY.J CJuthorshipincrile rs(r 9Y a' Qec.יcȒڠ'sayȯiPpwou?̟]mpu褪s*pse;cuAmhxBruelz Ƣgiȶ 9o YweHP8rahhughì8Ipm safeel`curعMHParn"rȨss@ny@(hx at8iE3XghiflAexuн(xu wrongc@Эan𛣄_Zrno`mX)r.ȵurnghyࠂyHhiqh enhim1unmaskzshsfoe@MQ[Iv 0guag(Q8tiɴso re@vaguhxȽpctual! OriBnrow@,ookibackd.Oތid,IXڽS[pg 397]a/>A$hsh!bflycol.¹I nk.Qy1g׏l82nfihaclue6OcseP@tѷĜnsАBSnsпvarious:pyⷒh,LPl0ٮ !s@;,nbroduc acch@-al;I(rdes)debɽproxal;bIPp#—IoHzOrdBh*ѤȰrej@epabho`ōf0n8n`WTmHrece81HiwЫcircI3 ؼXd(dʖX/a 8nisHxeq2r l!HfJ2sma)ʿaй@ns@h rcؽSiɍSو+gi٣aunurfala8Xa 0 uc?acrafenew(egh рthatheorextraordinaryeasure,'politictlwayssopenithnirfumdrum.

THbillame@tidnightuly 16,ousetirredintenexcitement,losesuppressed. 1leade"kmdtiforAvoroducsturi0novacury\speechalf-a-minute.Ɇh)beamal;aroviserpoxaksYcoursMr.arnell,؍~pall2deepbyhgan,unusuthougheHnapveh dant`haabdity!askingXmheXr cceptЋ rejecaA,obe0eiw@pr!duXo@explaits`Qts.Ȏntw`rreeeِhɕP`?XIEanp"[pg 398]lsattoyeneQhadai srYfac-simil9tt9iBXuinЈ)worlibelaunch9publmandilid,;instalabYmakarga8zmyXokcodowXЈY,L)gonde0! tinveg,hoab(memb+llegcr,xkxx.lepos=0001379834 id="eref_249">X/a ѥtIciwՇggSfȤn"XvolQdevienЛzzYicatm P"sodroppoff?rchdiscre2ransɜha瀘0ompulsg2Zonnqc؀(eaguri ȦѵS1bparliw@irtpȃdock oôȅXoR(sonhohaؕYXassoci:ȷQecert.ؑIshowɕMyӶ5;(ulq؂YGE0nisےr@le|ԴAceeHnd:ybtrAragecipp2(ahluf`Jdudvo;orhxaA`Yt beѨ`ht⤷!sk nЖppojuAmia1$xi༈x#egh.gxLfrustUYloPSllow;pz#rIun!n(QjonђC,(sL(sooxstAu&fromG.BGladٌĿhliv)Y࿘po`arePXdo,QX3`Ireluc@ 80quiry;4!lJtrviewn0a`bem@ButRasituveniѝ:tteXye@p[pg 399]/\divLF҇mfdayiaYZadrif`ymnؿuȿp.h@frfo۽Irish4perxxcuriYdouqa٥⿹measurبParne`himf!y Xgig"cHٯliagnfрhenquiry,tsastxpenseinterminableength[unfathomuncertahies.ndayppo!dorsecondeadingf:billmcommission (July 23),omerubjectept3usinessacktilven'clock.owardsix,r.arnewhoasoebatpniswndca Hannglishriend,skpeAeould⁠iQhimQg w8hhour; w`exanewurnac3assay1purposesexistegoinicklow0؆fixaSo adyc3u0Z@extraoraryanPWQrimremarkchat`perhapexafnoo솠PghtEwhich pan0nt>mbegi0H(speebcriticalccaZ!st.ndifʆrsudJ`demeagrughscarceHr$nlear,xR*ܒone(ctive ڈDec7r+l u?نjudgePlimiYPunl;`shlarg9Hto0ariJitatYAyxl˘3 Zdefinhcifi(chqgh`nHdpmbefarlinؙamov[pg 400],X8ngxlefډIrqccI@re;An,sai(withHoucД(ievXQacu`omajo ful xkenortu`ح*dpro>蛅nsSx`ayupAiina簸sc̓8B`@(ramp!hr"a鯰jufallac syynZc{[:H𱷡ZhagZaurlaw.نfHXdArpyomakŀcedOHlik/R)Ad be`acdict{HQwDaдxvqȖ0!stitHܘ(óact͍undertHiruړbbu^iavailab872n9ȔbhemselvahobѽCCzԻunhP1ceiv]ʉy'{Pe.

AQфhowanswerX9taadɤ9wlr1(olu#nbillhrequer8ittBel)ab8RYUasڭ׭ԫ*odiv0xcircum`IperRnvensص,soreafw:+irregu,aviolȣsyb n@arYim rhCЧSmcsrk`g8ݣ SeeͼȄ`duxshifLg2־la*Jury ؊ ѳhaXep QAugusGonreOcA@carri\CoercsmupipAi)eay‰[pg 401]k>ITriblpX 9threeudgfirmetept* 17, 1888ott ir;dQihundbnwHy-eY,roseҔlatimnΔ229.͕an`urfiftyn8wHamined.ύؙnselxrfivefo(snaPirnearhHlvsammc׊llsllioolumemakb+spaИques)spnuy@nV-.p>Itbangeanticcctryiocialppreۥ`ctorsvirtual9docktribun~pixop0(I4givɢany塠hvoieP(ᦸsHrharpscoppoF̙҇XEngliPZGrepRebXئ`p8ЈxOg_^tGaryGGpod_odicHc0cr8;[pg 402]a/>laqfr C,piBɁ!ombqEoaguil؂unlp2v!AdAwhat:qattexcircums!ac1ϫelmvbphxprh1`.ɒ8vityid,WuX0iaxdiscus\tse , wIhCeswh#⠐Ire:acapabm(ؽP. nommiidwhe2onduwhichi(uscHppiǐ"d,%sXi*u{bfQeg ulɘy0hɵR`r,̶)SalisbIapudrrs 42plewuupisodperbisy. 249 33>gg@granigghlefalYwho@B(!&nstbpegڡ+erP ebeg1y digQmulVm,!Ihz5b蘠뺀cas,nAmBgqn elp `n eso8a neؿP`L"ȱڹ!easRKer@iezw ow-taiknee-bch-omcar(t(o ubfoИٿ*bogGalwaٵvmembmuriclub"brYodyMqjorarybo.nҾmpopxBǜЫShbfetadunge ڶw ⶢobbi@arwa)MተtYmoonliȖAlhkxpoo(#blue-hox(loakipfuhaidnrrorsharppP#rqlДpincrex c؟QcrosAthunXinx葊betrayinv켙rH;e訚ploP*𠇪)-roaan>[pg 403]

Proceedingsnourtorverheeatirenesolateabinswesternreland.ivisionalommisiersithiredgofgrarian`fences,entbafullafigures @ocumA, lordpriJxtqmagistrkdetectiv9smartemb\thYamousnstabularyorcehichsarm,yephea e@ishnaIcharac`d]melodramaX0crowdedptoorridorɇ0#tubroughtutpo gepsursȎatre.cp>Tplyett (wnWmostxsomerwas呑r"alaw. YobjMaccus`showmplicity_Ydcriby ctleagumakyD5;3ruliabley!ӂguilty.itness0zducKseemCermin,2estove--twȈuxg@Mayo,BsPny1CorktyoGalwaybsixKerrhaf`orەimmeah@ail.ӐIԟspokeonglx+qɃ"dmo2 igiQnrse.oYxYreadfrom(uundrchesnsehsidpassRmaagaHtè`kŨsڂ˄ hRqualifyqonptg)himthreeusroanePy!Yୈaidll1@uʢlituK0roomxlytX8s2?Δ0ʱrosecut;Hș@1x@@g:tnQil!h.Ȕigub(ɏ*Trt,҈ aup(x@ideepodiuPWeekwYuata(0*gleto Ȯ (opt騐ickneglpopؼ.Ϙh7jbepwanraypIica;7̿dHjw|[pg 404]a/>YPlyzdi8feH XR;dploani`(0ine nYaradAans~Oypday (Febru5)ur0mpب acCAt Ih唸car` Amcؿ`dฐIrseqA`yM,nhiaon8,PB$.ȓw3QyeaUnitStatesٲ:ҹm fpScodٴPh@a,ervic tr89scвx-belylqиhovAL{briieМ8swio0c`o|nfepٰpmÞ-na-Gaelr񎩂nev0zNeworoIdIЉ)inIdedynam0r'@wuy.44555> AX?hooSٵex(en(H@rv+з`fgetfulnc:etJlipihraLtwarelay,Yhad述inklɆyenstPrigorou-exnliih?9reaspR&tol0ҡ2a(ai0lruX)hou0,oػpp H`Hcca ewarnb` 0temp @fiiYs`tseplXIev9pQȡ[pg 405]

TLetseachedthoug Rtt yossiblɊanoiIhav`akenlacetaoublyd1Ȍ]on go08bsig0fish,lXeafhwardsmyPmporawXm. 9judgesow),paPcJrobabilitiecase,$xsa(s@altook`_y'sccx)X|aPymژzߙJauppolRisa*e dch guasєim`agrex֠locuerhapȜPexac@futtb6alkoctPZ?ךlxened.JiculavoksubjБȥ 褢ɭE7atur8[z2orк"n0!߇ޮ`RarꩠalAbX߯spost`ৢҵh owhuc;ϽmIɳ)enقwyѶsaAfi賠rugg$lo`؟icBdefer$Xvilprejudic]caupelevh 0@Yx脘h mԯHٶ׭oAtt༡ӎ1hYX5mpXYpamphxŘӴismnm,,Z`mialYmmunicaRim roken-dR'0un8tuHnt`u0littdty`ookaself𽐱1rDYse#).̒xᓑpپIg9PdIragi-edbarho wrewrote:TIdiff1tgtؗXbwaPmxtwxy୬(oeaPsuppyB)mr`fanuilan8ctshichustorverisgracee.eadowithineaauineaHday,ndXbesides,feouldndeavouroh`anyocumentshatightvailableqsathchargesade pamphlet.fhom(tatiob!wastruck hXl:travellingxpensqaou@pri.׈`ewontheeedynclo1pockete9hredsfЃpOnlyauth؈ historyQsJonan8!Gtdo0NVagaboLaauntyLausannetripcrosAtlanȏpnces@t8neysckwaradbParij(Jؒr-Ҕ@tuzhenerhapshumo8ousimpp!solemoxnew0fs"`on, ah)'edʕxalawaaffair y TFo8riPExplodedwor0aros8confzфB9by.kp;aeli9o [pg 408]}attackјitXdbڮomideb,qexhix;op iaMhGladXſpgAptm1renМgnagenusympXr2Pټr^suff*odwr@/divH3h3><`="+1">VI%/XhuZyLwn ru13, 1890rch

repordiscb(ousesstrospeechesereade!rt (Ma3)ropooʆBdoptʄ,)nkjudgȉэXirsimparlonducȋiorAHʊjourpPllowpand9ʅeȃauty rec@sarob fharٔ,gravemo odiP(scrip,⒠calumnygerybbroughgainmembďR;,hideclarssfęosu0AZi re"[pg 409]div>OnbRhysich8cQisѦWPu¿Xan0iscu\eni@liam8SHxy0goyetvȱ mn[9iu9.Ϲ3ѿIH8charУ)soɿذҺpurxf򅠌2;lidoY`Pa@ll'shoul`Hghheiceroyithconcurrencefprimeinister,ookr.arnellntounselponRdevising9alanorrishovernment.asarliaowffirmndecord(findthattadcrupulouslybstainedrom(ak1itswn,youtgaЅun-alltiJPmorȈ2orswr@dgit?tbutyy?lIPwholfacqgrepsi1880-1dress rejecCompensbill^grow8X?al=exc ivnts.ԑjudgessshthXcreh؁survey.€eȍnotbod4aimiymion;qaLЏHtes, pislat,oliticiaib_]rangcircum8guilqjusey@il`soo. Suppo Imxld,X/a p>

T)b;plea"pos`b@Zi dXtraxinari)xercebspeakcȮ%acquittapalinfapharqopdtX0imacgnvincYbey#[pg 411]/divOnRrt[pg 412]bunal,nvented urpose,჈withoury;tllowpҀvoice(constitutionfzUexفlongBharassipproceedXs;8rebyeviPupaemendous uniaryine.Ԇhreportduc(trrecoilgaiflagrantiolencponccalumny,atdibirth~affecJmargxH, dgeeernworeparties whomlor0dshXyettled.


UTmbp:pagebkxml:lang="enЂʀ.h2>Chapt IV)ɕprim. (1889-1891)e"P nyenjoyed,ىmyvoprd,ֹlea؍xȵ t.Gs)Imu0cern򐕏y oGvillen>Ja 13,i9cMtaypwjeop8,{regahОno@nbrouٖ}a#J PymaddiI(Avividnesbeliefalwaya2 saimtic:QXa0enem )elXeyAlpTgtXkeep"h`n:, siʒbetrIu@mixal. nҊamoun8almoecۤ*414܂HˮK٨Y`tlq0bosomƒ/HdQhac+_?n>𔲠dom.׷Wrp.orlew0HR Penbtdoutrupposth: Ze`rprIw؂[B2detailbЪmXɵsun xiqu!̃AgxcepY&a anxietyڇۺalyѬGeryذªopinAywfulrr98titutodangXlPaskGWRd`it?wwxڬ;{famyrh㻨Rqeyook`aZJinsificap]Lib ф Psi AævisYak knowO-cinHIigtowЎkAlusf`bل{Q`wif(happenou*gBryfDY9x Rpy alϺϒ@ɠ whoaodasȺfaM؜dd`c. bePsubjectePnndo(Пisoa 8rȟYbunࡩ#1hڿq2 pratateringlace,ndonervatfromhebstractionfaresatmonuallyxink@historicalapuanri.inotdemoralisedcannotish Ito}ep.nder*circumstancFortunasdmin@eredslightery|hys:correb.숸-p,raxrTufoock∩50,000Hns,comeownblhyproproaetween8Naples.

<ToordcJa823, 1889ƂRis(f@te8givp9shЅHurioH knowoueasapv8s, cgrrifiuto?(.eapI@Xjustct e|Y muchfraidEP `Ixihgo nmenqtntrYltroaboubeYeignolicy.Ԙ(Iearonl`Ifх!lawK)YUmX,O[pg 415]%arQouldupegg0(iRwithmApeak uninvHd;itIsopsil `ءosnٝwhhfeelg.hbrok(@ɒhlѦnonymarticle.ȊoGxvhPanxҪ`wnocAledgsfurshdiAinc,anʫ8xiends.S2nesity0ctu;eutH脉ubreundJhllЧIxvx@`doZ,^mX.=T!AngmpHQюd_dHgnwfirذerta(񵠶secregut;!on8ifd`Qׂ׊ggpaytt8@s2UpbJnaXwhtxhaps嬱2wh.a5ermڗ\(jbook0@iAdش#M)hbYJewOT0n dl Ѭ`excepHittbeHawarden;³`aa8ЌɃٿ@sid@a8di n)@ish)gtseemardeQde(rrialuA iZ@sem\@?g٣:t*[pg 416]Ua/@TeH8c becaua􁒥qLeontopoXعtP?ϸ|fry-hhD

Whleftmalfi (Feb. 14)rhth:fopmselfʏپԺcesswɥcrowdp+incluArhiR`蔹a1cԾgp>AR`urȂ:roaQL;:#April 28, 1889Lloa茉y.´jruIxr0BYlx Mvxb1dao:exhtXJhZwrdoEyearȽ˸hpIckthfivehousandeworrespondents,fhomɀuldladlyispenseith 99erじ.ayoupvbenikelight.

I 0b$ȝYlm8fx7a1brAwbRucleuIXcXbegȲbuilZx0Ctok 8],i nyvice?ϴ3 (bhaleyugȨronfeshee0regȴ Yp9OOn>H! ҄$aDr.al?ju(fin9vnnfhibi`f admiX#m̙,pп8angiskporg0icquyolm.ȻXHgrtroddDer;invariPʂ' /div?kh3IIAonf9yiyZٝؼ,wppyɨ֣Qedśjmor <:3y`߂too8oemember.fdiv0p>Atgah!S cerouumЗ1888,9If@citko@ed,ordǙhve,1behalfau9subCyp8(`Mr.Mrs.ladstonwortrait$(addHspok*Ylo0靱roughq,8enjoyXQunclouss+(e.5ԡ auH.inasndour:exd  Quifo HhriȞjtchTinnٞ89hAappy er`ffec(cirttachmP`pHkX!dutyPfrwzntarnisX!cbr@n.ioȢHawa nicFol)atmosp8 pHsiZvig ьph;qngكavPecoṇzn airRrwisX 0miэpsfolkCatm;nbsQobserv]decorumPedPpharisaismhp"Ndi{ʳطshitsow0`$[pg 419]-a/PBOfHȘAA@ؕ ts!hgo)liSelwyrХe|Melaia 0 vhs mi[pɲˠamQ)uXis@瑡೺k0ѱI`huf2la0Hsq9[fhIru︖e Yaen8gue`reg@al+AhiefubXउidep!mprlle1866060>llAбȽ@1853hmamp*iH0PnȵMrlؿЮf `chyxrexquy(exȡx QRg()Pod"ec˯HGKeγ; HmiHktr.ׇѭx؁9ܼѾc)aciXPdedn9p@oB;inqušjoXn߂Idp2dpsrXbessfZnrQ0LlmИT2ۺs@=s@butyldX0)i0knowIYwapeoh`tianor?Waldyn277CE1>adȥجk8mu8iməX൐ic[Pa㬀a8iourpurɦbraHhexaick|pep8kHHlcnخXȫ18311897,ndromhesetppearsat1831o偀of90 xhadevotedobjectscharity religionpwardseventhous1poundsinjremaininghisifejfigurqacc ttxtrteeq4five [pg 420] redbesideQ0WTorzcherishfiɉhostelZlibrartӆteol's.Ȇfri lyayHenTaylor,󀠉onennݍifounowwan`alsithy,geitp[keephHsommmpor؋ngboutmoldiefeolonialficB1846ytnobly.

III/`

Nwq89ለvisitooawasr.arnell{airqgoodreeeasysplrybody.bGladst@'wn@cors0mpough3cpsub1affi(Ylater:ۉїDec.,Ș+ReviewthrewmllZpob0sibam rngIaPnQ,tc.,rmyet(rrt 5.30w3twoHu3satisfac09non;┙ГgrosA2X9.T.moȅ/.鈌/+e8inУ`eo᫈qkjIx)n.ook"astleseem:q@i{jp>T kٯpxygbeesoȯPx9aurnimagindHogu`ight iupax(ripiecep>IsprRo@ek1OxXwhichspokimصphusiasyࠀhonofXASould@h2X@⇺ zrtu@XeshIb)a8rclas0TIୠatPnunanimiagsٕBolicie8hxេfasc@9by*`t!ҧom(PumpIparadheagesrnxRstufdK0ural"rᳱn@rM(Feb)}H9I0 AsAlauɨ`HXunhrXyA[pg 421]a/ c(jXix8occuxd ti+@n4:,`LondoюPP@PὑSؐycot.˜nfinidQrooyѥRgpXehlfuWearull adiumHtntUB@дrPinclu*LidAЎAwhoPup-ruثh`M8a8Actuyng```91Hxric`We membX\ᡋs0cteyospitaqtXgaۂ(livZbgooperhapha `sIx college;h`ˑ.irھworkokحеlr:X0ޭwix@ȑsQd3mamyselfУ0شbXarlesleH=0001381357 id="@xf_262"̀Xa%KeY2o謉o(ertɾwrYab OTai9sou{`XWNewattle-grAAbeŽyٓyrucYȷ#œ4Hr{Pefit,YSؾ him)k(mhikeQf`(alyܫGuissotxcIhyugg0,Mr?zL,eأtrixjrifeexdregrli䚈tqservic рcollege.ymbitionsoisit andxfordnompanyithim.

IVIn 1890oNewmanDllingeried.cYIaveeexskedrom yuarters,r.ladstoneaidAAcx,writeboutheardinal.€Iareot.irst,onownough.econdlyshoulduzzlȊuselittlegaAa.wasapie0ofHbonln C[pg 422]a/ ac8intancreat extraHryindnesshwill؅ȇe`(thinksefect(whig9ow*Piesww scribarhty `.vsipublish`niyrmonsi18439t`ghimnsafeposophQnoqleri؁warmdmir8.o;2Pbee18oTractC.heemUi>general7>xerfuQaɀd0yfin@(me)hmIp>OfĤX`tuah!accxo)eekprH,a>݇r:eemyw*xdisappo8oux;u,spokJx:iutfreedom;so .urHrreXPioccas!n`-th(f`err`]#;MاhgzneȲ m)pusɄҴD.'s k"ciouГҕf)9b5.׽шf0orpculȿImeaسHobservҪlodoprro8on.ȡ!ttitud(`Rmor"h eologknewZܬho@rّ۹ ʨ1@tur*muchE$XvIr8ڼ۲%"valuQcteady.gJ74uОCwalky(w`hocagittim(oȼhowzVc !dqumreperuyretQhcircض𺉹tiaНany |0s0XJselfdetac!JA)Tr@i8 gMseᔓ@onnhr@xpSn H3@-nglu libڲI9[pg 423]a/5H"polc.ϙRTchurؿhPishmP@mptreadegatwouX seq;pwtwidquaIn sHАtmalatows`z*ګHuZ\Qq=ifKbevaۣstrukIXhnti-JPiQinemlnoV

H:ȴȯyhoaٸh)຿eHdays:рJ.. PaApapco'guaciuiOOaplepos=0001381715 id="Peref_264"XVavHouSymondsHre-issu8volusZ? 'Tpyz.hH lipo?ϑώSureӖi0session9nelooktnlZy@recontinuousrathim.ȗitoig, *izemass>Oh,ikeictsquetif؛onlyf-an-ؠe0nner;bbirXPꠈPs8 [pg 424]/dawn, afnobelltremb2ali,হ(ybodynows?>Nodo.yy,diadayseep sth 9xa1skirs "0poetryk'm`vidbetwee,erhap(gloriMilton's[emei>SomehowCslipp from`admbps Hn rܙisearcs_ePi]rlo __聰h` (ribl9whdrWWWYpwQsop)`aseneloprejoic;e*anROdysseus?;μ11148`80h 643k7 9 56595c62793Ӂ˂с;1ӄk)eDŽȄ3Ƃ(FWT874WS5W5WƿHalk5deal0-nz[H@*0fnad1dri*ajsiaticǜkhwx`ScotHwhȑ bȕIsun@me2sugg0Johnnox. yqmu(wn8rmwlmȕ)c;شmparisonr wWŮoѠH˚)mu(⳨ЄchooHp(sIn'Hse0yHzapgBPauseg>#z ;ruhdoubt;8maglYoupcharз`0ars yms@iaHkHa\I󐚷2vghI2pifiquality''n>Wpoke=newhakespe\"a0IZb*akoppHunPqvol..#sجgo#ill"ucc(Yume|__ϰopFal@ffYpfullֽ=erapggǃzuhinxin2amletGä8hus8itXclؙolistranIrets"u!nBifis?;keZyrious(zXorldؑd?producm1vouiלReasQQd߿x'{mo{))s;[rofPnalysfplojYmorcataPoph `ig$dukdeeprof(rUtiस.xtdokc;ъs@ڭicismg[pg 425]F/>Hesooealthy,jobjective{simpl`forllheoxitiesfodern8rbidnalysis.

JWhdooucket>CqInk#hoqInnociii,Buh0nesstgoodqq򋈫(s0idogmasubnti:;<8poyelbigHsecuѪ`Ccrusad) endHnquqxByzum.誘Iѥڗ(aadh w°ru@/umLnsЁiorfulfabrEвIEm0xasG'?Oh,Ionmyin :XQbookisH agՎwh8hapqGibbon:explxdecfcam8boutf8AllϺϾztrihe Ҍanyg`HRomRXoػieln qpehreXIK9o8lfrȦ˅afybuiltpoi. Rphh jpH`7i/div?t*[pg 426]a/pȾ="4em"Ђ


#mbp:bhkxh24CVȵPWParn. (1890-(1)iorious0sh h@pQXh(00.obodiqdayxdis(di81qYasYڷdriffeeYXLordҽPolphhurllВXzdL3[XliȘisPsunuC2(aظip Q.uja྆fxgon af*veetingsfnyortoeeld,xcitedainfuleelinnglishinds.Xllhisasfxxeystemadenoperationo(woears.vstrongnistrganjyIrypressould Ёandt18188>heyeclarxthatf k[pg 427]a/p> Advancefomeule,overnme`w؄Qoakezcoercivapp odious sible, y:actu.ۊonlyplxᎪeseo),zbywa-headednimbecility, uaangbory+8Xm镨db reacmg(Bp>Bex3epx 1889lectoral@g*unmHaka.ifty-threeHe-hs'cHedpAbeginnHparliaAet ul#on@exXer(3oropiႫ{secretawithharxeXticourȗniemid tpvi9iethough`0nH ;vilqHsuch Hpxcesghttail,vٛsff (gxgoRixҾ`no`ى@AXAoPyhQ;(Ec8s0viscas0;ltooklafyzae(de)hisMrXкQPNew0tl,|bpexie romNadsn2g@ssurwhiP򸱕۾halRtw0ciHة5aw`xs)y[to`xqppEj.ƨir1xYw ԺϋEtriumphka`bhntimajtile=0001382439 id="nref_270">#X/a>lgaugailuȱI0h qupubpval4нdh輦Cburނ|opiqSadimoLJ521LJ11LJ`( (ss`mwPd /@@3h3

Athendf 1889,IrisheaderadeenxartynXsuitorvorce.e`trayedo Pceah0demeanour,irofris HHouse,embarrassmentᅋpositionearliespp`anaf@vilews,asdebosfirnightIsess (February 11, '90),pao!bou:a[pg 429] >TCatprophe/Ayz 9 mnaXec9MaP17thB| 2meezTues⹡25XiAnesEnglѻh`olqIeffsosh IOipiBȣY 2̑BG*rĚyHǔfollo`˸@uls`` Р1{Ѭr8MѤҼ󤺹 i:/:misgivyr@tiP?morn!aqeHrl͛GDai@Telegraph϶,ν8leh=0001383182 id="1ref_272"TXa}razfrom@AKI ȭXu*.¸pqpla÷`gs)yDma[)PthXysu2Sm)ow؃xPp0#8facili8R..oȱlerp*akushipж`trigr`pfRX˼Hem\b.tsherisharliamentaryqty,ndatloneohicheavlook.

9ul&x2decis let@ddhsh@ byύ,surporb p cl8`nHayIlanguag`h(rtÜ7e.ΐicclefu0aprɓAwhoJknowxumsjved.ɔir*nњpunqu`ablXvitinfQwri(Iiewpubl,Z1 (l arPNov. 24, 1890BswMȃ ͭeyWRHavarrAa (luYreg螤U pS,է\/%Iris@y,ɦ{(nm؅1`QȹK iirhwheIike0rh٥Gl selsubjy`p0D [pg 437]a/1usgaؤiσϠ(*K n(82xfq٩riimurPhnixk,7llPlghotȆmo2Ғ0AhsibiH9s8j+oak1ehilnund@؁Rn uiI腁du0l̚;WȁgSyЏǷ -0msoڴɄw ,M e!sѸto-hrowJacquto"meansJbserv{refl(XxpowerdKb0qsple(؃(inȾ =4@ntkp8duHPes sast8shxdegrerausrIrelthink!aywtsaskyouoo!r$0b XHd<IeakRonh@ehfri0zo녱1i(embIss[9reg/iberba01 h b m uhosecuυhmo0aulѽ0Tf9`beggh/(:pf@ahɛ Q` lgu genl`ifx@lems0;jIp< <:W..ladstone.u/px/div[pg 438]}a/p>Nommunicbeen ssible8 rfforop0`w@n0ormxeived.͑Parnell's r`eBrepshifdur)weekSdecreO Wednesdaeostiff,rou lcolkbhah(st.ȗ7awpfhsomeAg( pɐؗ;"IrisheoIgim`aion; stxisoo8ykiimFFri(,Pw:(Nov. 21)ppeaztHbakᙺolu30;ft)goHniTyeizKm(PaPsiʞ8qmmed:el`gwundircumcesnotlikAwi(Pso,΅thrown"fiAs2Hi8o`rdsɢPb`qa𨁉Qrein(alrans0ᆛX!nI9mlQ selfਊerilz9 oniliخiakany8Y `xleXsequez(.ԩA)laau`cewapchusHSgu(ino)xglurtf)Yoraclfmb許p>IfWiaaipdbώxu8awp[pg 439]div>LkObdur@ <:3Imerorry,]?paid]\thI0uldotakintm,htruIigymageldow8o_[n0tooateUdžLjXskhimcoؔ㗰o*Gladstoneroom.snt@oə@ridor `inmparway`haga DpOXunl M,`toyI2heaA\FR`,XRAmunic+p*1@wigh@d,@lxff:I8dI[pg 440]a/U{letyistenInew$onaceuitaHenougo`bdurԎRns;las(hbfeelɎ2it(upwsoHpasХ!pli"owelThalfEng;ØDmӜom8tritytefiahbrazqY,RxruP*uo/draw0imLۉSAIҏfroactyl@hipwYupublic(nt;neprevYI{tahel᳈9circumstٌXjdepasysҩBtQavo0 Ђqk,vп@!isȔ#u9HȢhdign@ yoyɹ0speriof1kmindŰtwo8ʧbeprXll bh oanswpȸsldah;dfutm8 8!X yCon+osP,ԢaiP *'/himsibobt)[Ʋpli8nt߽gaHHHrurRigA!oA)ң2uتiQosxظ?fšl(b{wedXann@thgHfcoolڰXeLunPona0voiXunshȯ0Bal83ꑹaPmixڴ>IsPxhȞfurpePsooXs陸.zZOurse,0iѿRedoxnŸ:eHԾ0atta@ixpZa2hd9OSo"臦pp|Idoh,(rrظ0fputeA۽f'clockW??askeahmΣ)|ofap良 Hyou8(_ߑߓLeobduɲto x2IV0tota,mbɿPt0 qz[beli{𵠘iBnO[pg 441]Ua/bht qȪriкɵmpĬ8fnsПa'T!o ?pan>< saideU theDŽ1Pall̀(wibringtutnpecialdition.߆φφχWell,ut׈IersistedepghteyoonsiderQaittle׊Reluctant8heield nd 8wenouse.arcourtresjoinedsnZbencЂ Hb MaddYadeanwhilenunnsuroiad0eqO0[pafhwardsPscribb8Pralsaz-occupi`nten.TWxWaengPce,=OH,UQe ә` akIѡnoAlpKmyself,ȝamalabyPortugXqAria,trycxH1 absor#onBnxcommٟ0diromȭ ,.^Njcʡrep0e:o'clock,wifs`aiemxxurrex-min8dng-roaskq!0tru ieqseizЯ@joa0BviolAfqoXsuAccasPጵCJsUnlik!lamaTStxxchatnhaɧ2!isؾ@erpronn odohrioȭ(k QH@,PacȞ̴`retaruf~fڪevolvA trypspindi11Tow hPۚ@isȷJ)(lPy[pg 442]}a/񪺬ckXfel{,`Zmȶaffailifd˲ wot5mti0ʾAdepthFyive@ryworkpEHɉthm actfndship`)Scottj񦱎<tabecpHl:del褠qqAmustm|`;1h،nopuissavoiHȼarhorBriamt(udde·(nꭱJyokhp9؊w2t`u9brokHof(prful)D$mor@d@ɾXatarcap1880o g˽Hb#sampaign9P. _Glhength,@xragevic.emrecoil0t9 ]|sHi)al(aqUarwledf8do gn!meaѯlؿhdsequmcareXceanm.θK9n",nic,8غ:b;jifϨ% 2anxiymee9c˪ smoodi؉smokp-room downstairs.isacultyfoncentratedisionadyhXtimeevealtoimeern3atruggle,ndts ensityenewinuteexl rylem yperbothteststernrel.悐dayseforЄA[9preswri1suspicIdesigns footecclasticaluars,ough9declarh8pnoarmmayxvermis demoЋLe|HallaqfXmpulsive.nRhыfideafoundBHf*dictatorshipBunshaken.ԏbHgo,)libe! werebunrshmsprtesman'scitsedly nnor8wouldpontaneouswithdraweasonx[pg 443]

Mr.arnellDecaYR`|isorganisw app1agfollo`promptturplbaTb`ntpȘ,he`8:acquiesckeeadНrm{l)ngTaePYpolihژآ,nwX!Cworki0idireR-,2cY liКdtroy*xceacy@'ta!Гew.hhўre8po1oopd٬ Amcaiuxhis(8oich@sw`w"just(al0 8xb@?peMɔ`,k@Fsmov)thrÎharю ursu.nluckiltubbo@ defcanap em`خ (irviolpitcswe_1chs赢nowqcee!pxH3d)CdwhbU8iXnagach,@ti,@lenergH!r`ed.p>Twor`rivYmda+qoxIys, hpҨAGladstxpasbКm)趌timȮll(habitupr)xpA黨aʎLccommittؿ blackʘte:;Nov. 26, 1890kSi`hemx85 4@lif1gnت@uprereg|quFPdI sAf pmengag{lai[rqupؠXˍiSisyphuж׶ѭ@ҽAyXerP3yPPwPuÃɖ阃tІs.A Ay`10p@pЧ derh egiXدȶ ixsaobm!:lp9ne̒Sym "A fewek])jLoPal)marvelzarP av cuIcxcyl K[pg 444]a/ahou8@i(babriumpH Is0!w 8bnl;Rxstu(yewguxXyiqeࣖexcludXnanHiؾhȱrefдI hippdhXqlaua`جcasx ?vd;șJashjvo(^kdom &ʶ8l,gh ЂQj to-9ir٧CaffaiBr`sMdothqor腤yeskPselfmӪ8ocir8`s%HclaimtiAabsolulitJ̨~譫kipס׳8T)fowQwfп8H)y[edphkpfulus8tkw.

TIo8onda8noon.Žxʘnoert񘨏0(finl,ڐAmpr@r1PUfolloswqwrotetLMorleadcPPrmproceendHctYmuni*# zstrongh(su0BJtakec40Hu9`fuځwriX9d8ulipimmapubơno9ll#De@/y.hwu" 'had"not ;[pg 445]%a/eftSSHɧeʄPmakm8rialwiHoPȋ،tЦhdecҋp;ꤨo iɇPaM)Gaz]")giv ?>@durseXĢ+Uobbi˳H@e/div?kh34Vm}cd103 32,pQSt7hhgisheڹ5tabularyoQrv۴ڃauHy9ndeHia[xeۥh;nxitime. fidtrunlPi-ghrnyathвmpٲlieuaponع8sH PoduaʹHHccepplaciPXG=sr 2iX0̷iavowةha0cY+h@fluq0bowordEnglead1eHlayf_lootwQrayal.uchzounluc@yjq0Rsin O횚phdrovahɮǩth#ZfolloJTxwX%wolvfouB, sai!@rٺr߶bisX0F#y itlkYsp࣠(oxsuspic$в Xgaoh񹰦l0cPjwhi@p" HyȜohyexسp>TrepQѪepisodpp8wqaspb-whPiscuss8ɷinmexngsgrt(l,[pg 446]a/>hkPXer9xj(p'Xs.Σ8Ppos0Kd0< a@rXz1PoxsibimH1biP1886eYxCྐྵg`L,sugp٭ңaJP0cluٸqask0ex؀]quagre theealifficultyaynindingbestormwhichrishpresentationhouldxtainedtׁminster,utothawwisdomndecessi ofeavdeliber freentiltimeco` akpracticps.efernoeriousbje@anyoint;u(lxd 8sthxyuguQdisapmPaspiÃApar rXthienial, HkPHmselvesowtasifr.arnellnecaus8`al`dyxtrayed,yeParepblack8cXoif,RblGladstone'siQilourump `be e?Xs*m wnuiattemhcorrupr(pro89absorے+іEngloli؅yan0ficeBemolua,ɍJ@yəpsona8phas`Lqdo@xncern `h,rwlse.

VIWew{wIitp:PamrzCommi8eoxFif`n,ollP䓈hamgnex ڗ ismpywn.א981א77>ԥ`ceeqtw hd)鏓wwatch@nagpjvpbasurpassɝ@aAmca.i pctyens(dramcsissuhuoignadoubtҕiЖtscenKsuifq,ro iriepeia nПvirtuclo [pg 447]5a/PIA-ooensCp>yillustca0Xrb(BlnksighXpaiӑQYmportXblroupϫsh.L Ykeepuiet,؉/un@isЂwehavrevAourhx EwayHp9sshIrel@olif ga趺nP amlp(coil "erlsvXP#p0aca"infinitholdemihstuڵəc@:wඪpridBLucpb tuhngʍlsta8SalLtNhIdonbespier@fouinBzugg࿺HSruin.Ϗ(dZealaHerod RRo1K@ZJerusalemsgtɌGDloojwhfuou*ѽpXu9y[sixyea((public cfurh8mls聦sasaЪ2Pia0xmЩbgias;ӳBHifچppntagaah8gЬپZthqHognobx aneQcy.p>Ish[ztidraryȔoakݿȈ((Laxstlɪyeظ rowdieel{ho soRispld.xdePds,view.Ϳaf@yseaȼin"sp2gн PepyhXr,vhoȧ0judgzsXɟca(rXpĝWhsaech(fir)pSexZyH@ymYASqRedmo .nvЭ؀JacHcep2 gooa3ڼHjttrspudexarlinPyr!co0smawX!H!nuq,nuo`cighgbeylima{e8YBrimx[pg 448]
l0dgh.xiA1]semgiv𩀃usehatodyfrench,erman,panisItaliorveniEnglScotWelaAmericanoliticslacednircumstancesequalxcitement,risingrom HincidЁitself ooidHdyprovocative,ouldave8rntraHwithyorH-control.

Mr.alles0d,igi@shr(lofty, asf,div>s

Aouplefaysater (Dec. 2)ivisiontakennoomifteupaotAmadeMr.arn@'sest,oostehescusuntilyld@certaQviewsQirnstituents,ndyeetDublin.tpastidnight.ԃlargeX,8mlyedyfewxmpscle@lachorse-shopab,Rmoranalfshadow.ll,ieatuare(ernihY!gl*herqdp{rty<[pg 450]}a/>bdcutquȏcolunmov@t(sknumber29Xoay,hiȌ44g0.υmajor,nyHȒ0trialith1880;rspmonthsYuundp1firCoerciActsuff im m`sides;fstorobloquXrat1?HousCom09 hA$inghrough0ʒHiniPskgAlongrdeeeudgpPoj9iCuns0vdelrؕbɠfoX@tstrugg@ho0-`sawSruāflureck0s`awAlicy HgivoPreaQnhopenXb otQfosh8suiciddetranongeɦevHb rusHfinkyimaginhvjm9hasuchi@ƫګHpcY`%fu ,a1twoЍ?9ߎlowcup|g]arXvoi>ombP)ncomisulɰasa8boay+ɠopfuill.oȃ⧉hairء"aioacc@now 4odjour7ext.}TIben𵙉tec?8Yq0p,rev hegtcmeanwhixolutemployq.Сupp@renbl@Ҷ5aumsw`sZnnec0aapHlivp@l'sriuv2eIP)Ncshix?󬩴g faUdel h`uleG譀fPl!QafDŽ|Fp(d1be٭iompet6 ewmٞ,op 詐9 (munict guate iPA #y[pg 451]div>Bk-Upf ̥tyiftoH!astime.

Itasotntilftsomwelve9sthexcitem!шesqxyscenepproacQsuchisordPPhpo Yf :ibeknownnHouseCommons. sahadguh9upXimpassi0bronzblimself.e ongmadyrePXeutralitychaiȃo8spe xBX ؎yXIhragxnataapfrom0oZ'And{hours awconfuonlycap`oundedclPdeЍ!gp.BMcCarose+xewXathP񑱊PssВ!opinaX# q؆tinuingcu mubarrxnyhbue㚭[pg 452]it(nЅdign{*suggeQKho`8s)mXnmov莊tablِ-rlleagu stoodDlfowm roomҁR B:wbainorIAremainnumbnsix.<@pos=0001385261 id="ȉ!_278">;Xm/a I/div3h3TVII?@halecaAllo!00etdarkx0Ѿ9er Y h,ep-furr"f,ضsa@nciaDays:dit?mȩhmQs1QK`C0s;aҘ̼QdiനalH诉𨩻Xbat8towxAwheKquP4pKilkennylTٻX.Ba@xauȫEבת$W,gql2pؼveheh___9oe!ma0n?cnȚYed?ǖǼ:etx)ޡ}Ri@ge((xҬPu8baتaËd(0no9onsry㽉up@)QftGPer-clap:lc(h+kRbO[pg 453]a/>2I1ou1nkP܀`c (1)Aaxad(2Ԕ?OJ.ͥ?*It opot .uyIrishestHI$w0৸bTb.yagGnV,,fars@ce/BpetlawJ020w0Bл06.or83icoitorys'gitjy@aw*bmpiصHSem4ludicrous <:3mustooktheutuŕn># asnlyivendortymightHearfactionuldpringpIrelAiferegohamadeQmind,whexr rtayewehlos؇generallentame.ԈlaPnoseemeduitutrageou"Mr..,Bxcupp{hadvdoad.ppYouSnoegrets Ўirt?>J.͂Nonen(.ɍȏinevitabltdoubtedpdoesjprؕlnta͂xoItory.nglishfnce9alwayroȘmischiefBuowhelpeid?׀8aAnanitypsiXr.//,qntxAara؛memorumtalkith%HawardȕDec. 18, 89{also`o@tHRownrpoliticRsP tidivor0trialHm co Ka bulary˥omarpaumbXsXln(etc0aglin8hdeXdecisP.hiq$ki(feakɪhimself,8*I}gety(leașohxp(O/.׮ׯeGG___1oa۫@ichPneimdeli@ڥ?So@dXJ[pg 454]a/gDorenytRiksIdrsc鴕'Flo,isa,ЗIic#F1hQIEmper\gates/>I'pt-Y;I ink±qit. .8٪DDsiegBJerusalemnnXuhTJewf0`Ζ05125a6924480Ⱥ estTitlegٿrarhċ!>w@`lueS۸qrieXnewumaladRenaultؒ_Josephpaɤc3innoHim@ag@з0fnsG>Hr₮oogNm`m1atuqdeaPgfoll0x Odysseeets:m amoJɿAHB:4K2720G49;i53:25qh2:76Bh:l166:3k795:6ј ڀhd..OM793K[T0"ćDŽ,[ǂ7be4j,SN>125 800;kҋ6ǏۤR4v6{K쌭s?tjb؀kc̒cʎ̈́xapos=0001385707 id="pf_279"XandBeautifuѺ.2̑o/upa0ndword˳`un8nslatabl׸׼߼Oh iium' ߟ߿QuuoudmodusGTamri capitis.<2uailepos=0001385995 id="noteref_280"Xadiv> =pJ.̓Thecotchord 7`wearying߅߅݁foromebody.nSehnsucht7`/p>8nr..entffoisibrzuup􆰉(nce,ndIollowedm,u聁nlOdysseyǍoppat:passagenelevhooks lefkroo( mesaid,QAh,臨vedif:ttutalkbout,romll3re`pkXprepeaofustow.ȍr'sesulaveutfigur|madhortScommittecahweek!__:We艨wosnolcs.oHb (ood-bye#/*[pg 455]/р)afoQize="-1"(erdealΎ,Nf,,sc8Runluck.ߩ>[Au`arepؑɃppl0mp񲩨lY,Ȣptdraft.]tawȕ8readyrpЦp0w`8noix'ckouJl8epL쿰ppa}bx r0suggȲ"agePrguuthrasesornour,indingpXtherrificattlenworodigiousoints: (1)hetherHughtoay, <:3afPhistatementfyiewsǂorGGGIaveowullysdF ouaiseo; (2)OOO!Ywillemdoub0ssXbablyur.gMostharacistic,퀩amaz.taaPseveneeve`Pwouldetoandynuay(atlookБYears.hinkP)pdhadPen,neellectualapartromsmarhZpcekpersoxAcomPsi)unluckyɉh`ard wPsPe `ome,靁0ldonpfollogn bed.YsaЗdw eAntonyBCleopao@C(avathȊroHawerowde cri(ofBravo,Y'tmharnP!oPlyeelYleftspitf(ts/p/div@p>No adhHrx@inxamp`unrsdidr.lads0ur!eddesXicengH;stfHloyal,nsiKsyPHexotr;irm8tieQn@Zw(t;vhboerw5agbeup9quBo.΃wtYhaken;2˲rkan`opTublmischief,Jro`LoAc (Dec. 27, 1890),eNpu!fyPi.8bmps`XvyQt[pg 457]a/pyreceivarq[g8aiokyɀs0t.Ǘap>Occa Jldf" Irelحiqa(cancreprnKilny;1ɁyufXۜվ#To.oy3Hrd3ӸgSiirIartѫ, രsrenzXky3iTecPxl鎢sa9bɊttitubitouchuy;ys@enHrbZH-ȶHPrHe`oguroluppoR𔈷ٷlarge8pȊᴸmoȿbh@toItuҧ8losure.PePa𻀐l,ikeep9ap arXOn@(ibdodiACx w" Esʲ1ِ!:atp@quiJp՛rgselvPҖfRfurtiIreflX.иonImhipMlifdadxmaٷooix0ekHgo8 pn0uI! EhelfTeutlookextremAiHsI:axxbackihule;aI ,P蹃rmdan:fY)P.@ ?d;@vi"QitsJeqAPdiminЇ|c)!( xWmynoa`tvao7affirlegislkt9pY!behalfXS9dD(s8s8IR"@sngth__jLoAct/>JaH91Xyb( Aw*;eryaąusicsZ"HampdenaketarmonysellAmelody.utɁveeandmhainedohepoty`isarn1bus ss,every <:[pg 458]dayconsidernnXhaperrhatughtabXaidYmyselfNs.P~UpptofoliticsinallylosHfuXqBrshiberal teasturingime.esۈnorsincdivor`courhan wPit.Ԋmo؂oundrhlatiofilife]/p(Xhr/cp To.orleyHawarden,ec. 30, 1890BIunlong0dȐAankIyouڀ@r;0muchalu8letyirtha^re!midablىHusual,acnHfzrecepdis,8ich,owA,Зpom2goodf`offectї)ly0 usefuassurpInow1󒀚𘘃fQؚRo3friends/n>IJQeقbmȋ蜈seriousdd ],hiphreathhelp8Xpilgrimage(fs1ty-sixearld;`9rejoiɠinkcaУrmplX  |3,VIIIa>renth` roccur٭SligoXagq٧hadtrb@r숸xa%mmediugglhyben_^173_[2_2_>Htr8C@ow,:apresultSؐlia(joyZbR25233> ೔vQadPsncolefYutXXotxalt(LhBTк0ЀGrattaҁ=O'Con, lloIrsomDavؚ.ϮsSsidqeH`tagonism)kkeyromaarea pnreprob,owynrfusavȸ[pg 459]=aپ]-Dhϑ?˿uthlessySe8nmca 鐠tеYetxdadulup ltɎ rEng2@backwee`j[@RYؔYaggard,sombppи邰h2d8flagГ,muȰbKɔxaraim.|8mѓXldbg`B@YloJYfXow-workށwnow markŚ)ckd desox-.ol0hsbQaCiscroaim1ow)ngjeeiy`dٹʼhr Xla0speeںكВNewcle-on-TynJu(1Pɕ"pabouile(ɿhmsai㷰B&sྊew<,`d#ispZopeH+VedӻȜBcH39І`8܊U76330734747ܧ60/˲Xight="4emȦr<2Cicero./p> I(guagg(@c귻AzӦonv!on.דrheyn8sis,syallt,whateverJform, creedndaithaye, whonef0atighTvourhouseholdo,nmerson'soblehrase, <:3livromrexdepbeing.wH=p/divp>EarliyearordranvilloongadensstHiend,ied.ԋ losydhse.sctonkneweirelationseZAwxiroteor.ladsHe (April 1):randmiraafitne08ynI'Zpwatchw8camh0Xqeasspi0mu`separЃQmentalXbit@Xlyffinitiev@̔yfund coc,inceYhobudget,whelmerty-eXtʉ go.saw onne+piA|ootocidePtookHsis publicifeprdfiqr urcr^Ėh3IIӖ2IdefѠɑhohyS86ʤat`dد annumeetqchief8organisZ2otiham (7),“耟88MancQ9)P A9turniG2gY:lXoaras*wardsbeowV!grammahockX(yuar,y0!tin㕛oupa1alru0sxpйingPScoti.Ȍ_ҩ(ulps(tIeXqonHor@aȾбithrؒ?OpȢnts[pg 466]+ais 8arlia`wɇa(rooor,eare#e!tɃhatik)y wrong,ʇ(prsabodynewXڊN.y.levequicknithnemS,owwv1Prd,Irespect*ackbone?/p>

J..Charac?/MhG6W,e;es;蔙'sague.tansЁI. (IL`:t(Novalis8w-knowneȑc= ampleyash.)߇߇OinferioriaoBGreekiscriminaslanguagpnɐxprecier φ1108057i4963262;,9ʁ5145Ё`f,tc.,ywhichuɌearou!coachEcsH㑋 nobePrЧ`htincS!s,GZ.]Jan1beG`(qu(tiesIdmڞ!қqcred!virtaumixy搹40ꍃA}[|2;?ⰓssocibqInessϟYAaab(sorȆ<8oeign硨ш(ChrIa؇kFridDecembH18>BrtPnPne,bicoldawi0blo@gtraqomZMaimelp1alkH,xadJtHafb@kHQonyroom,8ȀcejHPra;geniu bopTThixremar0ndPhpix,To-03薀trench@diedW欌0aboeloetrȴdoh0quhWcurfnghtoprog97_.)ssixteXhOehInk ar`wڄ*encviiieRj@ad.oCranmLikexrthcothe'd.ĉp#JmyoerPspeLbrHstak[pg 467]a/divTa-T ucydi0lж}Txwihdecla>(hXepnorousoӡusкcomparlR4artaGe@镊bXst-r@!;eglectx9Csmself,qce跠plХlg8imp8Y(hunrssurphP$it;hsaid,Eehks02pxcepQuicarch

J.̀bSurely,BnhatsalmfifhDasttliche4? MrDllinguse2confronteitheIphigeni paredramayH!shхIadnown aa oghx8meginneHhis purgself<)raih.omwaUari bops. ixdbpinsPtK1igydelۀcircumptoh,*;EcclesiacalommissA1835-6.Ԉɞ;savoirairw8pdarliamQduct.DIwaysdeaulPe.C.owbo8suppod8kamT@aIxscoulZpr ZAmCider§@=fricqPUs av٦0wear#I(s!Л8PthÒXkHhr e20vAtaЙ`discucЯ app3`Hanimc.ut1)٫rguXagXTennysondescripN뗚Q olaw. p9سfak8qbe؆i[)j!.utƌ?ضB.o;qЩunaw impЭ!doom;hawkrit cyJlrdؔnnp8PY; 'tdXhY8x9м@unfoelGزXHu .ɬڷ8bab"Ҽӝ hr !excehManTp`asYOfro: ssɔ"pbasصologTalk{boMxelet0TQau ar;juHfinvol0ri`At` yAs8l soiohaxter;0Plзfblavaphasy8diq ohlbvioladox pglɝTmu9Xedmi Ap"hurEM31$P¤ԯx-suffҪHurfe8Qi wber*ۀXµdgowX;s(!,rhfhoz'TdwJ iwpeci`a!1r۷skeep2Qa}Xo[pg 469]a/)div

J.̀bDon'touhinkEmpressomesutellncorHdence?Mr.ǂYes,(showslwaysudgmentndagac'''Ah,0bess,or@Aasuch(tegrthlipyiallowedυχ(ra reluctantlIught).s `arientoinettewno@trikingharactpanyns|hiblyrivolous;9sup)eXst؁;Phahc9itaconrablelirtToncaJreal@undatibe ofbbeauerؓ4,RSishpcretarytoomIragic厳!Queen72Tuesda Dec. 22isin*eada Xong.u`bot.lihxstoxbattCagle:Pwenapoleel@unciwar,2H;saitweremAin=(irhaBiackq,ug0rAYy톑oۄlike`aouttYenemqtK.ExApla𡼣Iliad;AgmnȈTpsXowfuassemargu@Y[pg 470] selsPsoeignZeuohadreX;ship DiX(urste1,݀Ш(@S`n0hiquira)hofirmknHi(fromB lan؅ձl`tillfroy.Fxle8=0001387568 id="`f_290"X/a> rg`y`|lfNTalkbK anhsol#pwhi)monarchfhEnglYi+@riXpgoPdow¹H؝Lord(Y‘ba!nanol ,{uХwo`ilsnIHas8,whImyparc0;? ans{Tyhaps " Xit!!nam2 btƴJ\sapiHageNewռomdeкH*)phemQyonApcmbhkp: .Ӱ0s꠨oocqu!lجhMpoqSneitƄapproa)ourkoϺBpaAp.׏0IRػ#Sщ!tocIccepefeatqenewmcyeXnro0doubZfaqEcclical

AWelshisσsPwait ras@0hisonanimous%WalesهhselfhouldhtsimplRXScotl.ɀoǗځЃ,؃OJsasyRǙَon ?difficPaood@hmo`ދpeosupposi f2HYtackit&[PerhapmqY8ٌ:aptghlȞfreyabundg#upec8sia(ffa s(Zoxc(gdC0ligicd,ȡBiarritz9anyk(e.]PitIbAtrdenun0b(1Fr8ar.Ќ+drXCWQX1812@XLipool 20(?)erQbushef 65s)!XլHyou `ogu(noqaf.JSEaton,8stnor٬g`talacwYbuib)l eH謘I)priyen@mexacu[pg 472X"pPChubHskepeyګ (N)Za#whȮre!staren0@maow indulg1n;ẂhuѓY1ip.†wѹxinutЎ9gyغp˼chaZrCChrmD18918A@vdbrillisunXnmiPs1i@P ذdmirrmHfro@nŚ 鱈ac,%za狸ʻdrtAietTno(ub`ngagφ11159274a8150b4048q80053ڀ245;׿SDec. 26O`#aQ.ד`u AcarriП@Np( aqi1G.'OccaproducAktapQsrownHs[pg 473]>р

Fuentarabiawhoishedorthersindereas.No; uBaxgn@hreytoom@YhmBɿPwyidelphicularpYɸhairudgyWWu+n 1ȴIRpa!r2goo9rA ayⴡnX)hYtڗdi9you=/fu O_u (lainрg)Ah,'mfraidhatitseatherard.utoryself`ink@canruly upllHehangeasointo(oliticsaentence;[pg 475]

Di8tmxistakewbroughʄdrustndilikeibertylearneHoelievt.ԉiskeyiIXCs.pJ.̀ZAccording!observation,gbwnenedifferAhaceasXei:ӎ(OtÍAy mi@itattersttlewayXenreeggot钘yёAdaysfiroutyeit*ysk?ra@thraofmpire,` tesXepublicZnarebreIta8agai9uniᄉZbbefollowbhrif`wisdom,Qlarc8se1virtupphss.mericarpuЄslr\lifځЌal,rosaic,soayыyrX sonDon'qI4IgInowbigh-)Iwhuirom)񜿕G9Mr.ǘNwoull*'favoudnlivednҊ0s˟ mw˙{0Rideal'z`ral(d`k pee 8isph.him,lk@R.,EhfulIickHo,o'!񾀚 wzYXgmwyЛcq2itɡ1pbe0z..Auiȗ(藐shfпXioiamo#yppo@ȕApXc@ocean4aTdgw jIlkre;Iaass tumultus!;n@hugذjwh818vamoFIɱɅarlYdebMacaulaAguDrit{EngXngue+8laita MilЎĘg@iep𸊫ߠ*plac7o㽈 (li.Ӣ!knewrilipop@؟0us t`spireAappP֌-{pexamalsX8igosabiڔ޺lubXmj)footeHahfend ?cIou٣ȁ`1Gibb?8iDec. 28WPiH @treakfa趗OxhdambridgeC,,rwucketҼupy8rdow֝sducXfIȜyah0s psolseLaud,eslqNewreg,ؾ"ֹg@ȶnрames,ewton.

Mr.ǀjInhearlierixfordastwithycliff,ccam,bovellogBacPndnighteenc0ury,utlerJ.̈́hyotocke,oo,Te8e?Thisrounremendousussl@ ofsindȆperhapsjsorfeasonsosepheaisp@hat Xtemptr ؋AbeginningknowledgeHvewe)D∀aaaline Europeliberalism.resseobviapointSyouuspa)ntoccouonly'Xllectualoduc@r genta(also [pg 477]divTable-Talkyqitself1.TorXurpdogschool( o unpaX:incredi8Sphow8lfreed`wZJona"EdwardstoliɬhMYhaзp鰈1rguLnecari(XdeȮas2kmodp'"Tuesda`Dec. 29~82-AgaPyMackailXGpkpigramYqfَm splشgivPmX2teful.ևXeobouqueadd ichurmornoHkwDLQ𚊡UAsJgese!ocultivdɯpuIurttdasSpa8ڔ@ag EnglZcapit!tarm`. ais`gs@ipqcD.ArgyAS.nearnJ!حrIffiَjataPerhapxhge]dhutiPcondiaɋѓ3alwxsubj+anxietyiracolȺȫaFatmospȸZcotxceHCdel.bai,musgf;•(`h pX(sv0unmwe@sero.ȼ0# mi)sIgisTb[pg 478]a/"T`waum(imuggbtum|sePo@majȥtCɅxassMsa;ouhlihYѿ2qnٌ 8hur9^p>Adino0azz,Ith[poor辸Xps0PoQZs!ʴsacri ҴAupB>pMormpy Penownageew;bhPdemocracy؆p`ascu;|`:wpa3xj XȫÝffº"aPetanbetrayPCh8t it҄Dereټ&,ؐXRsH˿Cham@dicHvacHorXPn񶵨(qk>l1reaX`se؇t0ühy%ead00bY(rdmabeoрliticiansreo(rapid P Of͇ g8xlflotwvague'ĆYϚll؄wetcL2[pg 480]B>)t!deep-(cses`dpfstrikiрngtalianutfheourseqmodernducation,usuttiEuropehistorynwo,nde+artificialulfetwee`hancient|worlds.

Saturday,an. 2SuperbXrnallRHterormucholer.treakfastomebodytxedRidleopicquipens.hyam!lengthBiha-x-soadBayonneћJtA?έh)aun dna"desitߦENo rmtw@ђߒڪnty-9ғIfnowxXdritowxs)washis8ggl`vb qeA0ap onsaw[aPntryٻCIffQrxciBg`aPttγcfirsq!avs؍!:t Ї@ cxnou躘makHH sweaimpX؃. iIrelX+sc‹pyes cY:ex`ar2lawo reeh(oydizzyz,ޛىzjettazAgsSꩁIIH@ Zpac Imced?al -gr膏OmayI4beproducӜtX8yмls$0s;cac(isticͪʪy(tJuriQ?bH pim`W.8;ezʕ. edom`8sendu8"ongmiașQcivil73alembnHoHAIʍIamiab!attiarkBRioojLoetsplirgiЧWUOhi,ucretimudyۢ sublimypHquai em9Hs(`os,jdisɁ!oCA@idռeaрnything.expressedisdmirationor [pg 482]atullus,ndheneastrongatoracouldunhybodylseeryard,reakutithinebRegu

TortHpararet;'etc.Nilepos=0001388651 id="noteref_294"XapDBlundersnonmentHowightapole8wsai`lectrllbvastomplexitiof,bePto@Aaatesman 0xhxavoidiggb4Hip>Itasydef2cmq0cons*s.s word?hey Yihdegre`timulXngacJw`nTcertainHturhoyoomWsen{Iwhotakdelfulerci(fhirjsollye8argur\9@'ȎTable-TalkDArnold~A,hrg0sihapA!mpo`byn)`ikXp.' oemٵ)f"Rug@Cel֯Zadmi-ľmp(M G.S:w s8geٽbലptge`LexpZrmucoqueSeBA0t09Gxnhҟ: Engl fȡi9tcHgromYupTennylwaoormiاso`zapji԰ɸpeoplbegȢsiAE500 gȸhabur s(`pduc8 mark|fi)xr월,yrW0sXt0Sh ep:J^Ihp`Ger`AGxhS0ЗHeIat誑 t.рuthouldayordorheoeticovementnrance:ugo,autier,tc.r..vidplynew(little, evenothingfderenchry.epokepzLeopardi nhom hadrarpleirsitroduc@imoBisHublicveroanyearsgoXQuerly

ÀWs8thsedccasional(dineim@hpIvPAlb`.Ȇ@agreeab.always(undami,H8asympa(.npoȃearЊXm*xslightfennyson'perxceD"[pg 484]JwasAwro(jbe w.suilia@e xrib ficialYeserhapsimselfdrawnxؘؔ mrmb@W.wAK,dneavxchang0isilktocksUano`phpy1stedG7=IsaMrno@tha'dr(veׁ)ybodyی9exacambPon];ioÚwellGrasmecȞ ,,Oh,ou ;!(=Ҥnutoukas P.uN@IBfelQaЛFtSӜҠMPxMacaulayst`judg]a9eSHi(rE,kDry amouspnp#div4[t5{..oolhop`voucdeceit;ă[Truon+1k-morrowrepay}ulsrɬxdayOkLies LwhiiHwhXstWWWR1joycuts`)`posshwn>Scozenage!ODzp>fae9cLucrpu9exc8@arkA(')pass!lack!yr(suuira/mwarm1)regXBsignclosexhurE*˩Hhf feeXgţƨclergyisHɨwrittgoooe.hHinstA?sknamHe,͵xtriNewQ({D Gus)Fa1 e>mToxLabXer ( Js titleChardoubXsѩڰitShomusical¯ȡىIиyʵget99utographaȼHm`׃аis:wGGCʧvolcanoleepCgdyA`__&So@es"@rP`self. 'T[pg 485]a/ĮT-TalkincYd, hsȧScot)90approao)odeOLPaHJa4Axuncheladstrel1A-knowto@ p0NapYih`brouT.ȪYzdinw)W@H.Quel vnet!H(y4N`n' n,_ȫ4cunouvq evQ 'ta0eؼyImagЌ ߓ9!akis؏(cos8!omp0ڽɖbManzoni8iXmakʔY 8staрndtill.etothointsfiewreight.nneense,heiant'seawanlyews;nner,heneinkhis!tory,tenoughohakieorld.tmoment, could @ecallanzonids,uttinnertomi0ha0ucceededpiecingmxge+apaft(gw@room*wrotmownoroXfaper.uriousljpassagesplendidranslation.

Talkbohsf]t;idneyerbertsГmoIt(ctive.ŒDu8PHamiltboxawaylmslo2aareekod. #OdRott`Row,aichesC.Ӗ supaxope-Sc gainmy:.opubantellectualle`ic0lackeԘ\discussQb`-lookmڛH.\to-.%WH(jS0bodyxpHincomparablosi;:popularitHibnompm peo.͖G.memؓ[pg 486]a/>[immedeC!mʍannУgovernH18274lgepQɟbeunfair`f strx(TRal8svYPeel)Öq1fri @madnorEnglxl@lm٧hepzf)r(حYwelveearQWrH{yf 8f|xp@Hir`shuXrsAppr(arkxABsimƮ#aOtCAy9e/“[UnIAhconsidYgift;m8mIȢi`polhxif(bhem.uIeXtu(hiPmood/Tues,5AI,Mex0inh0gx闂rehf؏qwPtg0ric2hpwyaqigu`lowr餼de(cSسdes٤2wounyfȤ䱐capitfuirTf05bgaRzhǹWe' 6Mladsi趀!טvelp>LSпsee5LoqeHjبPssX:aspFrenؕcatschoolae Pi7pr:ganceeasantr"cur(fHThi ,y&QmгiX}nreg;2@xmfZyh.DEh,saiLtu@nhe |Mahoui,'ai{peuPʀtyiꦈwAts!Ȣav p`quu(rotX(Imڀ񺨍huck1s(cituhj@-beҸxro Ox`Yd@mbridgewoyHщO`o9n09h8eduٖYSMpvezonɬengag 0xYnCno`ub z5[pg 487]ma/divT-Talkτ� ἄq625995B05Gx;9р

ὲς 9j5549ȁ726a,h758v953o952҂j56k9i t661964955.AorempressivepigramontainsheameHought,h0oldan,eaningnistaffikehimselfojwiredinntsryole,ndoesaaskwhatdvagtouboarmfforre rhurKyearsІun;zQىlecti0)out Xoics`offlifDchangPho!greaX(my,I@i1all-聸utyco-operai, lyodibbefr.r..amAse.emind82ma8nc@adadmirabproviQyoukQspur,urb,!whip;howHsќssdo مjjud`me0sym"\TICpdetchـ0c!ur`iX`iboartr9Ifg8ӜCATnistr͔lXnȣhtekon񨳃payul!cargonsw|ffhӃdFloy̨Iqui rJulo3oP`Barbars;heyr مрnoBQsuȎ±c. kB$,say,A.peoplP[pg 488]/>yob(c҂o.ٰ(rendx,tc.*VFridJP 85A)D.h  )pਊnsoàh2o deliXfulbIX!-n, ´le\MsorRI`ni徐)latogkBiarritz.Ƚ@8vXosл1SaturO9NStdb\enoWi8lessؽosuh(a,6taavyhill!@:svoumAdl`tH|va0fuӉ-Yyps Prf,!0`2pș`AtpXѥfierchFJXlwa(9ayonnwesk!)w)oauscapu(ttweermittрw⣰t$dozؼrMaxr'`ookaAnthropologicRД/Aauw(s 5.30;c:nip

Wordsworthnceaver..imuchomplacency,snxaefiswneadinesdpsource, story.amephimtydalsaid, Doouappen[pg 489]Jse8myfe.mWhy,repliedeag8IidotnowdႢ!TpeculiarlodestXtempAointPartee[tickl#rwelltightֈTuesdaJan. 12Ȉ$eterecoverfromwo Ќfndispositio8WebounH'salk0ngseneral,cluglicyьroacssHeexssoluts1tiXoulsurprisximAt:eyᇘorrigCarcannNismes,rl9:oZo RiviHuPk=@ !/div?90<8e="4em">


UTmbp:p8b(kxml:lang="enЂʀ.h2CterII.eƝȠAdministra(1892-(4)xiv.

T8begPTofficɝvix:werewettbviHossibilit.fXiscuxmȈorta@peoaskX蠘aahvers,ɛzCt@mwncIlfiɡgulbPHgpackIrishpart.Y~ nsآalaȨeykxru@'boha#oar;amπϦ!ጨV;/divp3h3>KII9owjox❹alyhxIajo@bth߁]ki h Rlx@DHStfӗpensڄQimܛz8wupxHpeecaop̙no跰8sgow.upbe8agI꺓0i[earclibrarˍhfShuedthumbe(aeTeme߅i!cqpprg|ɲcCaiPollux?'jȽZ;0Q0$sn'. Book?sai~No,8'msЂ*:iFirAMbusiu+Kp,A){ǹ I xঋnimatmodulLsh|bاbanhirushiffxulbeBteصs.Ȼdelr2j moСȄpicicxVw k\alduyrd1HrR"urfUdeep,audiZJmagicaɦweekpPK1ayoـQ#usohopmanyxnthad¹niī - bYv sompletelyؐwondhowcoue:be.nȣ132Midli(9rdecl඘)QZof 4, |3whiؙ0bIon8690.gJHoub:txHi)9tsngԮXpaign.¨؝BsPhupsиvex3 good@ss{ rublicfˬirq8xifect(che*CunТ) w٢m`c-roomئ{guctaiump88aea_hXڋYؿad*pIrљicӳ(rliнh (xss0haHilcuriousqui xvLtq:e [pg 493]a/ȟdivQuOf՚`AGin)On`, IIIItЊXtiybeendAmattblabyxiendsonoes,Shrundertak taskAgonment,epjori@norg0noЇЊ(erc)eoua09owo rtbservationsthiszseemyh.xwd@ref郈trؔork IrippolichrparliqafibulbɁmembers@duiwnxr`urea@beforeabsolurePnXihzaaaahOyahty?BaconfideɟI@Hxhim ` șx1890, ߁AorupҒImp!9[ly`jecfubif H86?hGSoustify`de 1r arnPP¢( rpeȐXHoffi1;pp9Kbak"ʦhe+inigiblRբ@elf@gain0aËoequpWT9saf`GreB8.׉rli alZgiv,Bfromisg Bȁ?9ӡ=produ 1pЬa[W{mporm⚆w r!hss x`eqi"s?p>Gqh9ipʝ ecet.n35@rgueD Melb($Mmin\sw(`oyrdox1iO'Con"t죠ty`s(dl[pg 494]5a/>ቡsixQahlflo@!ΞbL rpool's.uK""ЮpfxdxȯYǣ @obchi AkxpQGEہ񴀿8bxawhicheasaster,heyerenoodimeurmounted.ewen,fpromisoonmplyulfilled,Staken,cludingHor.ladstone'swnarticularatisfactiohȃ nYoldest [pg 495]

TCabinetllurvivriend`fisouth,irho(cland.emaxd headUgoverntorXye fYhs (Aug. 1@ar3,4).natlealecisrpithmobאHmea(Ȉghmportanceeca lawp؎sgagPWelsh ablish,uȐx mocp ou iographicle* sh xi()(om@(eisplayoyi(carryٔnbZbet/Ire)hrou`HxComs.5؍eigffairsssi9houldIgecaEgypt.ordabu((1887葀press0wa0rrangb@sBrihccupBunddefinitond@tHda0hB`ГX8vلbe accep(iSul넝troopsJbhyvI@8⡔chY)lry.rendiplxcy,w,Chtinopleor8gm eemitrofaims(ЧHfic;uȞ`ǎhpolicXfrustgotidid ptiyropBpaʦ`xi`wh(XAeutum¢벘,ambaddd@inquiPXo9re!lik9biA tPre-(n.(e6/>srifsuggffYʵɇћVl.׋anymun,saPOK&noosrڼexqmڍi .ϹXgme.hPmricr8n1JanuafollpBa߁߬Pa0 AprilrwHjecf?Pmؒǽ90477ǽ300ŀXǽ/div3h3IVacutedroit,tPH)dev,pedےiRruc);wnebdABaQee-k@uȯm`dBonnagBQnceasare,ndere everywrelseJeagerooustipallpointsJargumeqofreople.eoughtpportunitieJdeliberationnrdͅDnotnhatxcellxamcultivarhf"haranguoRoPworkecondary<,eas‡ore`Imany9madeHonTYissay,ounselrasakeĆajolbullX`insiyn ownyecauitRy.nighiclfinancouldrestliai0aQtrici!diffisinessynecpitymcasamongcggraЏԒdiscIa0figu hadenurnishedhimaso(dep!decl88trulypinousribithouprxd hugxxperie.

TQrucialyIres땨Wmtjcfirbi1886,'ems0hnoo!imPlipnt,ptUw(pepurposesaln8vpolicқplНJeinT1Amii6lectwaaip7,͕Gladst favoxdhovi V,v`jud}hteQ l`s@omdQubsequё.X"nowoduX (Feb. 13,93)؜p玓fromelhavȧ,(,vPpHmolxбxasxEngScot鳫YرSlimiCڵYsoho"lb THثCZE·hiia84HnuY/*1 [pg 498]a/>)rplefw9c@@om 0iaaRSG@9Os>Ea4threz؅zatŭgI diobj@0pal)xa"venuhߚ ҦVԱaxݫ_Iߤ/ҧlPohmeddآfXhȾ] @ϦstAj@mxޤyBritginʼaagaA𰕤@Yy򣀲0haradoxX,ly hen ۅ supporRat`Psuui(up`ppmajop2 desc`Y 3s'qa8baXhmjdROrumo0przmhabcummafamixu؄4alseP}uyaAu2ceagou9!sel pejchala9new*,X Ihadropm24ot/div3h3TV

momentohenioniststirredes"in"nat(al9,ndncerwiH@yxploded.hapidplendoursfisadirerils.ointouhimprettybviousrawbackZslingelicateueonsse0alo withohaʁound!Irishask0"oarearter1an膐efoluncheowhePftsmHiI,vkhMaXdyay,ould,bs 2c@ider.ȇxhorrifi(avery8ought. O0t.oou0kill?must B olmorn!genxlonbusinesDon'hskX.X/axpjObstrucfreelyasIprese`iefВ;b(rgain_adp rsed-reaspeech,jthclauxstpb.iP0se'clockGDywi#up,r.ladstonkec bɅ@akFWdadvx? Bi0Ifrait`takHooxchJ,:Jpl0;bt,3:t yinutepQroseØal'aH(Ctࣁ qvH arkab(0ceJknownse(wpsay@bser,somHc oolPc9erid or'r薢Hag`udacitxze1aɛ si(May 11).C١F0rioprrxclٔspok0°YPll-0by:cSn8suddq(!AmY藃collaphfrom ЮphyslhЪvoafadushChnct@klaar~luȋ؆pulZsetogerqaqfptOKҵEde`ofytChamberl8Qտqbeȷ;Awat`owinvPPmsnh.ouúrprlihersТS[pg 500]/Ird)unpЛGBpurnJ"n;y܊ɱT x@ssivs ٠habgooXH՜Iall[#pir`irariyquaiRdu a1t񴠙B.ydengxias؅Hflo0gXalDloqu@ ٨p0k8uXecl0riinflZɍnasd7)HdN YAmiȣghŪ1s m±hxwؿI{gradx1oobb .߰jż¨ItľMorleyᵩsubh.xcept[hetwgnsidr(o vhaldy0sap8಻n:as@slde:dalanxy pri8xh9eprYXso!e ȼpstspzlk QpÌZ؝pع雈wiYurraho/

Nnaitdirtn0mɳunȇIuupchiefȸrpo؀* eHHbr xtrairѷpШclPfulxPЙĮȐJty,9 y@8BuP9co跰9f hbxlQkeenjoy!ྱ $hreY0occxpooѐafI.ɡ2spYhab!ak) rgbillkKhip5. ߶e٠ϯ鑙asepO!kΝchgrҸ(deb!w bodyawheyouldotold.nfficialpokesmanoryilladxpressed opinion, 0intentrthat,serpeedilyppeared,rishposinallooea eTherenoreatubstance*po(,utven doseumiliamake0parmadbitteoneidXsts0vou@or"n1woandKradia!ScerQڂge[pg 501]

O@rucmustthrowPІpcomfitu imsX@s pro`ct=publictiȋÂireadersextremFs`e0e.Ix ȅqgivtp,lid͌XGladstȑэcr;jwhe,IɃtwithckinghe1fromJenemyough'hief 0obloPe9Prote@(ce lnfPnt.eginn!a0(easyavitch;xjspXseHg0aud˝ឰYap]8leed;raihim!cefulrguymhtsfin( Bbye-playsummatxp,howXriump Ps񙪐 ⡁soigh؜0naHal#ihaXbehab2firsNr2s effȔ8P;˧wat`H#amazdexcitdel ldrYwizartXvictorious00r؈9а#P^#yy s@rvr٬ɗحyaBbehi1Skerjai쌨P2@AwonzadI.p>x4nClad ҩvXGRI8mojqunnocQe hEAbeIh{d]s(;t!imor؂ooccupyH8CommutewQyeek&;ouຸho2debnr.ɜpdescribъdeI0urgimysleptғz(lsuceudgғPp (tellɿpirӶhs@ss)2pPcIDmp2rxvHs eb1s.OǁĹIrisdrr,vyBalf (Mar27),o.t 8beggtҀtqtrohr(yYXaffx.ȣSѾ,fpe Y诃Pifpselfs܈e;lefd=[pg 502]a/>\𱪺 Yfee0X9wL!RlpChlc8\ahsɽcىechntalkHXPZI8Miel FaBŠqpi`asp@th,lj"poi4Xx` engroeؾgra1wupCs0hr2`sliC‰ At(u0membH)齉lXcabؿx,8haq.ojQrePdySjM0rosAYXosalintиAcSettlre(1705w8[obӘ+ak(ayJfY:zbodPpctoricH`IcdT. aaw-officȍYI<2rapcۿI saQy[li8(Re,vjaWr;ٿm(ahm+d`ongeдYckiYzکsadvo໰ǁCwaAdnoobuc"al1mowXiadjnqPs'clock.easaggardndepressed.neturningteneou@himakostively*amusspeechponroceduresdown blitheQdawn. To =ofh@sort,

Undoubted0Mr.ladstone'setho*(somitteearriedHЇmesadvantages`耘cursHreatxponormousurfacYabanc8fllustr+multi pointsrbatfertiyim(vijrguscour isputsډQgift.lwaypsRa9needsbopiHhled,hi`perhappqful,indofQyxacPnveItrut oweHmay,=nхaЙ`ktwolay0 patrioticQijnowtX(ffectual؏la.ӑghdԗIliLoAlrp, [pg 503]5a/Tdiv>#T8GuneZbpasџyseh347^304, bmaj"A43ȳoci`virdowpo 27thir y01^2634ʾɕim2lunW?m~ 2fu1Wآeadh޲48.hȊmLoron"Ҩ{rohe560Hbeyeroys8걠bod,p8n 419C41ȯ/Ȁ3h3>SVIE/h3>

TheessionasrotractedntiltecameXlongestnzhistoryfarli8nt. Housesittinghenr.ladne'sighty-fourthi0dayrrived. Beforeu[au8,OٚBitz,c!(thpenJanua1894.Ȣ`go)ru omp"exSbllHs(ho@a8:pˎ0cX pic9soXweeksd′agitZbnpthyR֘Щ0agؒĘ ."from IbiwhiɩC[pg 505]div>[QLfissolurw鷫j9xs53Z^;rgi(qualI\18686;୸rur 3juxfiQb(`rosmade@ytye0ذ2i`oIM}8sTԮ 7067/a="4em


PoHics,Vwrxr.ladi1privpx@aM4,MalikyrȦ8fnXpr(cikpجHYdifficulzfi pescaṕ?;m.ͳ gdȬXXbutjend@ri(8gp9hui(Ʌt9ӳذpԾsuppزeffect excgQimpqmgwseembfrelachnaxezammhux.APon" theastightonths,rhereaboutthatecayforkinghasdvanced Xsuchace toresen+likelihoodQitsecomztrHl0perativtnardate.tuldЁbeenerifficulpoixӁthisxciseoint,ithh2apphqYmaRarbitra@choice;⁓nclosapiamsession (1893-4)(fxatural⋈k`twandenew@engagepwhixw"mirabsuit`Ѝ@n.0yetɈYnk,fotXrtain,bh8prob xeansp2qineofity㍢fvschhjol guesˁ+estimsfrudSeirjr"avoi inconvenie fchaX,ځ2su芛 yG@rou9bpp8sequ.Ԛectc[pg 507]A! ÂtrucRtiHicaus0 text 0fɒ,kompel :o9Aonal,P#adond.M/p>

T Yshorpl@elligiqt wnow@ned cb(osto-dst0 aoБhetterrmkledzMr.ladstdH9regar⠢ett)DecembH铐sircum y!.ȆAdPpee¬xbGreppfromHbh蝪j ookɞundoubPaHgoni8cͤ"four0sb allmsӱ]wrryurhQfregoolbeyojoboel䈨K$ԲlXco@'sp Ndo*ublxзPny ؗ7n@HyrvP?sawish8e de@*sraduyhvpɱ邩ro@@HeriC:AaayHbq` ouWs)Hp,aharmde@vivaGo凉s;PurZ4ܹRoQB; c@[Hukѯn`mselfqHIꬴدtris01fssimplw9weșm,irn`mPiseisppoЎHow,ask8T,) :back@mȇ bPдytswInxdi8e?r h0 x rvXli"篘хQwhYȁv;Ic,uPeH Hd*#CobdenԸ`s¦ڝjw lzppeacsPrevoluӢ8onOw٩QiIdraw!ձItalйG cR!a9n񚐿I0pbP1iP8nngl9aurXغesman8y dY4ymboϓʉn,XPaC[pg 508]

Af Anaɔmbroughorwa!a(mpnaжS菨0h\90ҧvPushc齪tiremѿ ¤ bou8༰ge@doifbeațitHѲR yqȊrneedǾжzrajoriȿ@d0pRadtȩ madeimitedoncessionsocaresn 1860ndc84,jthateadesidhbeenepealyXspxibleorxtraordinary8ncialrovihaving(fereZomersfeay:

Iiis, (1)yebudget54; (2*il (Ju09;votecredi*$70;agapww84.veonZPseaspeQۀhowneacha@qective؍besequel:oemnotXestablishdoantilit9vnavYowerEurope.heirmounts Pariou(butadap!viewaken`teast9me, exigctualhHsent.IIWhzHx0fpanh0hoil3tillabour1@fuu8ng1(tw0se dimport`dd8paRderMr.ladstYhul t،ffpBiarritzirAy`@Janu13.i(r, afroȞؙ؈t(ghiKsKex(m. s[pg 509]/ࡏWS-PAAtϑۑp>Ru`begaoaL0ei j!retur)tؘigËnaH*c sicbaity.ƊcommunicarYmad.au(H@Ijkmtem钇deȰ8ܞrܕ[Пoffirueha's g`@$ВIhe0j؆zef+pucy0irpH.accgَpu0Pd؇҉liIarrupҰcah:Jerkp>Nmeanwsbackxow2.ϔsPсZ6(Febr0)eeynabet.xw*P8ey-f?7 orogedqMt!`HreakQwJh1(ewzoȾȋ8ivldؒГimakXlgu0rilmoZt"aplIPy;ptX)'m felrb\angu.8+ipqnHmma`x bridg1gggq"wholQr0suə ç*(stoost2scribiH{ro0(.heʆbآȒ݌sie6@spg0infirmP˷[*canqAwavoZviawhAneryvup,M rarbitrcho,V?=eOHquitv. 27PHvɪ+"AEȫI,ɲuahssengaq ybeggّQmahxbusy!usutbhDowBStreet.=Ip 't!lhОfǘsaiheeril0O+mit[pg 510]<p0sf`hal`rxarHPpЊ‘psep8r@Horansl¤?HDϰϰɷB8tThursdQuٜc𘀟Ƥ=nc؂heSpҶi<9fnoػ ʑȠjl7 ոInext IudBuckhamalPirecvxb9sqsexparn fromim.isigorousensefoyaltyoolleaguesadetmproperndiossibleqbringithbeforheueenrjpublicsifferencjudgmentnhtters hichw,ote,ouldhesponb,8ۄxyhavtakectionxeerivedertainreაaudi, m@onm؈AthSov0igjseeksdviasyauccor.

wrot inmP`WalpachJvp:Kdiv>InmakyknowoourghnЇ2concluded,ɉsiɐnvٍy !Xwife'sarp0ankunboun Pdqlwe allimrece_^ؗ1beld .Ԕdevoa0@littworth;un)smXesrbya+rgg@/mayiapaPng1shrem1mu(com dIpontinuQp1HPpaA.ȃlw؎felhtygr0tH,tcL!C#Aelr%:noPaа$lɷ aigorpsault[?ȥɨjchangзIneptei 1884 1declzemi fr@I߾iorgaȃ羹dou|Xchief.ircum1cY se;@#oЎacxpage.׷Yhۖ(py¨pDb Ѱish 8p drop(?", k߃sm`moМAjni8IRhoqh@bermѶmHsacreAim(luc`hahthy򤙃[pg 512]a/>߬totJunknownoheousefords.Ԁgovernmentadesolvedatre0asereobjectionsacceptancchangesadeyr,arguasgainst#stillxightier"n struckot"pass@,ndpokeithisingire:

W0ompell9*xaniqsorrowfuleclaradiff88aemporaryrasualatuPmxly,utconvi,ǀpreposseăʎhabitfunda4tendetweʑCommЋppearhaveachavelopzisysuchcᐐAȈ*whi@wonsa;,ourudgt0n tinue.ir,owiso 1hardӃ{easily loyretortedXi犀Mhdid*٢&lisؐh la speeyl)6eagerum0folloromdamveheB udibIn 8,ros8btiwalkwfrom_hHiraddPAsixty-one"s`܋ h3DIII:wіËIoڽquadg010.20mSGeorge'sÍ`elmet.оonbwh !nxi¿k|abfu`Kmhܤm aXodP`parlix1gain@`rprIIgnifʭf𼊿DthinؖXIoo)@abm0񛊷Ha*yIH adJgrsoHjnAtiha`pٺ0ćhrePns'sّcЭ{Yo¥)s!l,sirIowi,e!dgralesWWc7Pibpmnt6akrHaMaida(regaasԳliȱȀn>dis.pa `poȪ醗`dutJstgshPʠHm`orip)littk)QQHbrovihhe^withucheightsttacheso耨ffice.llhis,ratherဢath0edeainoint,amelypeprimhinister, withoutoubteported.

Iu a)sl,pplaonxidaqne8`perhaps=memorablud(ZhiclosaPrvr㉠Р8fifty-thrpyea0oneptemb(3isworrivyln@larnWțbnМZaksh:woR`comm,dinkghpo_"bHk*&of\(Ps١9H (i8aself@s3 bpompfP 8llecɬpeas0̠0rsmay1cXneȘnHJPmrialpu%eg0vǕh0yllڑ:asexcXt mpxicǪ0k鏑doagompr1A9d(Зr砈X(؞|1Du8pCoburg噡I8sئC escapyifccas ܤqu)ey aGerWyQusEngliscu@t`bev/|qdeQd0orrefPyfwhomˌ9Yȶjview$`ff({=N(ouDsubjlЪ8onOqWwri[ 1Hwes?afrsS phavCap(raofem$ t

ߍd1Que`wrote0Iaklx:Touldءfera0Hynsknow;Jp.HAQkؠYsceXQmdramahǁrXPon8(5)Ov'(r(hrZaќ'!a(cherbay*j;Sdepapil v.©õ*uac1lupsJna(,11bԿisen0`фmcircum@҈xdxA枰towa2)ʾxelKmok;rplob psQ`ho0ulaIY)yYmadjccaɥsuhVTdidI1r꾈whol(Yegotism`admamh鮘K[Hdcaח#rW1,ybpecauHIh8pێ)e-Ra0Greygipаiaret߽zanorn׾>{2a8mbiDaZempploy@igeHrubxpeegai Pr`rememb9qrdUaonpa €\1mə@ngthougr(lo)ri!IjAkhuY@xCैTv,ullasooyto`r(l(dp،eyoc,zoacrInior'ำcaubraSir׺Scotawcurt@Ѝس1 s,ܱhg!R,Ǽ(TbIhad)׃StiȹQdesarry.ׅ翺UnwotfwykWheZQ# h؏a{t|di Ys@lpurpos裸Hou(sariyYYsummвwsA. H nearestoimelieveot,ndssuredlyeaduterign.

[pg 517]
mbp:pagebreakxh2>SChapIX.ԅClose. (1894-(8)A:firwrhovernHadome!dems,ursu(,utiegloؐXpfHctist(l [lifetimMr.ladstonosetnewxndiхxf2exi ,nowtsallcdfha@0SgItali@poet, 8xropes.772920739797>e@YLon%caЋyastB𖓠affeo`-attachi0LorYdaAberd@hn8:tollhHill.͠gainqw,idSalHous(ᲐuntiAlí5.20171010>nu5)9tookHfin(cruis0PSirXdur0'XhipvisHamburg,NheaCxnh(mor@Hinjhby@drep hadayy 1)X+ffi`8ؗm胫tquXw荨rQ*yalahdɳashoȶhld8hugZg0teʴory:p^pJu`25,14Fp?!myThȭ n[pg 518]/xbyrovid(GxaeriP8leis,ckonɂ"etțXfi:lfnths.ӹdri up`elfC almohsoQc˷dIٻP񭘩Xhu1Hasf*meB*ormӰȺ9`ryack(cramZccupDutwa,znht-aSp&ex`meh`.ز@nѿԋJtXPYseemqva`b= wAؓ7HwaGnpoѸngDuٹ轠Ȓȼh(8˚smurpetuldyIQ.uplitruppexcoppunhɉ;ejac@8rZ-* ߟMrouBYh(ȅئۈ9(busines2, AgoyeakѪ 4dd(yledg82$bUys0n@!sɮch ڧht.ɝ"inuI)أyXpcipb0֥TI xȽPP#Mayرfntary.ׄ0XI2eycaH(m8qnec0asu(u zaaXz:eginjrch&"-of-doQ9q L0dslysed. IQ ,?suAmari(gno/tsmHaXn`!ex siblenrelqhauɊYA瞈t()tionaseenperatednyorrespondence,hichpdoranyearaeriou`ur,ndtimesnelmosttolPble.uringheamonthxfartialhcapacityɅ`veotrittwithiowIprobyouler ay.ewhople malumbpof otiose
_p. 13."Im^APacc0yst0AexaupminfluenzaW Hyisuhab䏣텀G༤retY;Ino꿸,ngl Hhqpa)nwarpitע*or( oWp.԰ҿn(,P8pe ʺсdPc Q,ǿi.޿bpiuivڑanٞhf脩asGoCٝ:Yo hWn>OcIGBAȋpjudgig۠yqavou*ۓ:䟪enʢpJB÷halTmou{wouصpra`cuବlHak )𿉟,ipA9{opiXn @s cdiffrr avadrawbackzw@societyP 200ymg`cririals,r.eYship,۵Ҙࠨ]Xdeclanyurɷ7 (lu_XIuinuihmornerv ,ȐM Ц%۱ _[pg 520]a/MsAsoHaWJfy`rup;Zsdegre* +Two Gce5qp.m7(f0ap olª1dralmoyyzHgrdissfuAwal@gp;Cied9mi@xQ rrȵnav+p;l®ec c;ospoɰxaaweѦRadmilpchild`.Ղx麻chaгiyYmatuf!( s1hanuȹcapaci3self-proPert α�j49j15953b5;indepe(nce] (whichhereeksarriedntomoralorld).owpatenseseversed;週emssfust,odnowsreluctantly,ayurhsponPrs;nd4capacityere,opeak,ealtutmXercifullybbyrms.

Ol0gentil*Xy roughtoravehangenhysicconditions.ȉPis@ ydevothfnd,irndrewlar(whoPthmanskillYh0er8aorneublicestimonyMh1894.ˆforLian'srviceYrp؊@leedpordina(lifxth9fiminishpo`XuffdXttl`nterrup. <Tattitude,kaʊAPIHB(op!,RYvoluPs`iPsubsidiiXBڞ9DukzArgy(Dec. 5,Q5):Imy,hweipyPdertakȋIp@ؚy@leaPimpȀQrovetfYmamSh9difficuPkeepXePtempHM. nwhجtouchigio8mpspatronChrianfashخX@him\(f0i𫀜[pg 521]a/try ankbefI ,8Zqѭ8fy1-hym0.rgc lundadoubfʋloyeસm,㑱in9鲨phrasInɷye@(tifIassayou`y0on>b9Maxh)@rX. yW0Udprrcpmaʳ)ay)؟3жȣxpxns,fٓ90possibelevajgsthAralway!struck gle#neg wriay)YriAW,GЪOn>`µ@meey(Gȯو(Inow2JIښ1xrsl0ectaЖTX@mearg٦rarkaq9XynonЩɤnnglٷн2,|Bo boJAmc@2cepآA-s/y/EmagresʑiOlympҬnOr8roctonwarnexhscӹyIrIexrju u8na@colla0w rQG2Tyq6dR!yطxjpBostelibrPSt.einiolHa`,a@oPsحa`draw(n discuඨv(d!90HRvwrot9SCinRa؄8,Xm>PVrigum2:.xyclMGladspxuHfaZirtun pua.o1aw[2׋80upXaloiҖautumPY0y)Prous8핱vehte0liktw`y !ȼg`2bomhsHTurkati@ariaiinduc{adPheeBChaugu5êQaltrhLhrpool (Sep`24){ypar貘HeperCirx ribٹyplac1aesope8r0㶇acqup.[pg 522]a/H0Ih1876pone,eaidonefisons, <gladlyouldtartnotherampaign,venfsongAthat.]

Toiscusalmostۄdescribe,eourspolicydroceedingsȆ mattpArmenia,br8Iaixedntroversffect1tesowiv@holayannexp(p@AmaelliQorlethopeȄhyɁday.he"weaightYherfer0le-hed;hwbouauty؎YCypr Con(tionW({ԐD vokȎilitiesˆI PoHkindlgeneralaflagraEurgsrancdiploicelsithSul pـdrawHfrom̂H#cdnyooRpossibxmdoi takeaxaqueȄɉhich`ltorvehet(diprjMp(wiȁgain.r.ǝstwpbofi(repl.8oideepenPWRtgre2uءpod`hargea\ducwa@mypinѝ𓰡molorڣ0Qcommiȍ.cyכGAxĜmrespuincurYPars1856terl78.ԬHupshoڬ!utihpoolˣx#eakf{;bHurОwprivdvagȃli(dϒsuppsf chiefigȃ;(thHبZnecarhd F{ɀXeircum󶑥duسeas nގ40, !outss夈hon1i,sѯbe#CaQrun.IfqlruXi&eea࿨(6,NZhav deeparkspeeWTldȮMzpubudie{ ebir8ry:g 523]tDec. 29,96؁+zMy佈fXylud87`xya2)x舐hoHxm.nown:so4familyHfdhɑ:paia0o stricxɪ t)nxtrسȅz-a@zicX檴HouC`,ordlmش@8kn0pleexcepIjtwelonthHy yjm蔺decePb1m@ri@yoccaɿ࿘t뵉)JZc cd`w)amuhSpCanna۽`egi]c8௛ੁ8sӅinu:(pX?liHhead.ŵtemplffaiPನSRoHappoinJ(loosI`!utumn1897@pim fecLasẗ́׾ѵXxlyutharitably,oughnamtwoobe9dor imor repehisxpressiofnormousdmiratfGraham.ԋabo(ownoice.fMmadlongdgspeech1860,ertahmember,up)o` peAcIh,an(aid, YouusYker@re,9elywillestroyBcolII`mhtISfannoyaXw@acutdntinuHp xpHipr0d[pg 526]a/>$exceedingsp`vpItHd `aY,QeXntؖseeal8PlapPAdef8XnZwga0 SAXnh㧰tO,eebl*ay- riun.~63044ook3ePNȩQ (7)C(ehظ Rel8p>Stȭqh,"WelbHPActox~usuP8ylayex0suff"0ongla10o2ic"decidɨNtqret۝pngɡXtѤpall@0,wXQBne8twhimHFebrua22.ƹweek@w񻠬Y0s!o lwr0%jɿLady?[a ynarrowscaؿ!husb'sY( i؊In(Onar`18aȨXnouȧcura1Hilikeྐ)fhrPP e dicifehs@(yk9abJunuaAliefxٓ>ruhatartqdiHXgϙ@beepp◊rj90p8who waxip`Hm 0of񷉝"quigrt9HssklaIA l _Habdfulѡtitudsupppbȴ0Hin19chufhOY ebeъȟQioar@XsympB9}esntiw*anH̻)Ulgoxwishes.flowASlarHعlZPrisyᝈilgr0gMAȤh@munidX ppraym.ԕGqpno9u::}SsoofЈ`rroIhǾGBToHthBNae8darkbysA:[pg 527]/)LIllnomportunatendeavyoad.

FromArinofrBlack͂axcam0legram:Manygo,hXMontXgrmylovXl(Іifficultieanger,our quvopowerful (uccessxpleadworkonxrhalf.tti`vigorouproyithPbrightutube eq,pns[sympa@ticyorgreatnglis(tsmanwh1`xouch,QseesYsugȑ9eeldeeply'Asbagxh`iJobalwaysfd(prayzmbXlȕ alls ertak1Othh salupio`pitope(n(‰yIrt fOxdexisru;,Qlu1thy f:3divb@yerday's(hebdomadalcilr`*-chaPPHnimawaeIoulnvey!rrowapQ`distiacupHend`.hiweoH`unre8A watchxdarklouhfevenaZmlifeȝ)lixsah clai8o ѕ|mhimsh؊ .٤QplliacȢ loHpolixnniȰ1fihscholhip, d%p(iɧ ry,nAboгinabo cannot⚂ʒYwce1Ü sfa˩šG) -s((†pyKus`>W Alysupɔcn0#[pg 528]a/4¼mtria9 X`sigۇ//Ty Hnat )prooYi,Axc1`(dau!rfYyvaȷrɦvTXhs驗ChrϤh2IDyod-fsuXi.Y`@bhap akenl@,b!(mhbiy.͓oؚQrȿؾ urRlastwWMP1vid!drawy.Ϫ13ow[vi8fwCL9RbepImyselfKYsbeyeseim.ȄhdسsciFPجŅ9thPikn;h@ystPrcomQoarugg@ceaoANat@tsw0ˌ88wгlqH-ofkyp`iQgZ III

Parliamentaryributesusedt,ndorthyfheigureommemorated.ordalisbuwas`oughtyostooearesicoXsolemnity:okWhat邡akunanimouseeling?furse, xhadutieHdistPuish0himromllr 0;youay ittranscendntellecastonowattac0yЋ gre!nfluence2ableexertpoЌ(convictions!tempr.uhengs,hichplai ,d邰ow2ideeep`edouldotwIil(fervl ׃ՊxeJcard0ypolicy.yHI䓰kPs@o▐ou08anyXarmovH{mm\zmanki(0bstr trrsial0ȍ5QkdaTheHH򙰆withx.heri,rω!rong,m؁p吴ropdˌmP9녪iscuss1hpa͐cГ(lyasl`napAri Xre; yjplijudg!ifutIgeneKiHsec0 pewwidecifc.ɟkacpsبdɦm)[ulgcmXh=즊ogha 8d@P ak0imZrdx@,htep*tookOef(ZzdP0aXghh)l+scڤmins쁡ഠ SbahߦÊQhavXssuYphaspi[еhonإӬKrythrѣ)ycrossitud <:[pg 530]˻,"motiv򼨈q9kPikȭld"lef8qlutahiuxsoـ$ lؾ̪Hlemb s1u!ioQengaga3?Pjefav"ȿEexamplhTdfurhX(lelWW!5/divp>Mr.alfby8C?spo"s<zdeli8ФHmbɐvseM&aptpo)Glad8ne'PkXrHh)ĸXp AKOHſ:mpins(cXbAltog[atӽ߽صm8di($p؜iȃǠXn;\ۈ7i!imaCadvocSi1hiPtyPwe1NHo!`iuثI)nk ymsiXequhreplace.ɁB)e؛!uospahvax܉Iroba0smлrPciHrtuzuffЎB𽡷A-foco@ջiapduqdHc!c8.o@asqui;go@BbRZbɍʹtpe`tzraҠpu c XhoY1ceedingz%d"admpPȊxvࣜs ဈservicehoealiseowuchfublicrosperitysnvolvedHheaintenanHwortcife,ndYlouslyifficultostemocraciespparent0feeltoe1avoidoppositeanger0whisonymaveallen.

Sirilliamarcourtpokhimsrie(Ioialoague:IV

Intapsensationsaido(ф#hVictormxuel `Garibaldiiedianar@yprimeinisterelPaphxeffectX<rMdus ruckngl0iefincsharby ، hvotliberty.̐AnotorgotternHret,inpehsympathyMr.ladstoin#Qliindepe(v 8 ey,reece:JKingfir@unrsitham,clZ񗐘it|)udkopleSnwou8xmYr xeHFromoia,͔doZNorwaDenmarkuㇹŘ[pg 533]a/>morʋ, ћglokoNl;onour)pompo HfollowAishNJave./divH3h3>KIVﶏ IMr.ladstone'0wnmmara0iodich #[pg 535]a/e?=-8HPSOfЂ{p>hadsopicuou@iguwa,p({mrama 8an:wkPc`er,)say`it`ertainlyhargeabl ith3errorbjudgmh,topwhol(goveؑleabyprightnesas rnʕYsonalpectnipcmax2pЏ*.…XubliceGA+closm yrtiys (I8xreckm)ymymn9bMidlo`toompoЗˆ苩o؏ord.gin„ReLreycIgtR1Engl XrЎ顊exs ,jScotCpolitiirth,稸ua@wnexbHattach Yh"Hed)ۈrejoi(inkw sXmzjog`ed,ìJu([th-sco;zictȰ>torwi0Qadlsqbdmi(t9;gaXpsг/doP ąbe@cixRn(@dok,w, nXbsocimorٟhHal.γxnumerɀ8elyalmoXberlzcaТSen곩WWayؼ`goidb`е:P쵉ApQa\/divA”H1dJew9nxtHC*[pg 536]/> Yȁgtud\ʷcȗXeffa,Xocs:k {TghYregaucHix@0g(put(C!so0belo[}AŰ \葍ohonRiؿqexam Iceqyoqu@}@nyexpig2exhibits ءftarun4ؠHv1bpIwww㚈ges;AhakУ+±ǀdiК*bfiAsEʉ(@ٛfr@ӿpeomaX᧓ȯе+ خhhdve{ 1 rwhelporZPby `r sЯȲseelCan,admeXodium鼈fepgood;ԣififtyliaIdecisXȕ8Pkvifavou`؜emHHㄖwayemarkableolicy.

Tohargeimithabituallyousingpularorcesntoange xcitement,s ignorerisreadsctionomfheostriticalYmovs. Haan,,aiduxley,]2gteellecQurope,ndet debastyimpfollowmajo ؁crowd.>Heas led!qmirrDpasbhumourSƋxonfxonsmind.!hPh,ۊdetrors,utsortcleverilot'Hye8nd[curr9syritid(oJexpightatouldlo`Ico rbar.llxvop胆ruth.ׂhouqგst0gif艘istȒi` "far0Rera,iscl 1ncmri @ubinQdiravenr8e.n ynhi0rgh rkrla0Qfailupressrmed,endeavНa,ϝup@whicpenew؝jH1udepHp [pg 537]/)餻L`er,otƜerĚ0peB~8 axeruhbonxieelթs ?ϊ؞rapp9FinflralgeniQuiltqlan;8rixcnet;yrnpɛHCommY#begaJfic~tPsutoeank772(ptro)٦erٮʗGF.ik1 ewythleB0alwayڌ"stoor_XersuȰۉbvanquish􇪲ehPo;worhhSirtaf(drthc@h tuAPyapxЩoo؜fuChi!Ȧ±rempxuuydur%sR!)ouXyspChtiaacBalkPnspҸownoislXsp(k lflamwho(uWֆھPguȺnatўsuadmirabeffyb2if!gld.aH2LA1881BsX8Ndeep-@ egislhts.ȩȼhadx ,xHsch־ignora$ېȁ7Yjud74I(ځ**bIh_,q Y rocrhs|ict0oc(nctp>Thaʞ"eomјe૖profuchAYzrigorkt`acs2yzartffaizdPjsphI`Ѷivi´By#`֥PCuweikn+l (harity.ƨ democpendtHf if,شayZs@rm*gonZa(apʷҡ@^urv8Mr.ladne'AúB[pg 538]0"whiIlaspokeؿXagServM;.Ͽ3cmӕ$oXUbkildldjurdد!ax ; \gf(dJZ-bebyRret`ff.ek;choo@2membٹh YucsexIssimplifyp(sct0lɩh l8tothersoarsheyrebleoomprehendistorviwrongssharpeedsfrel8,illaveooubthatanknegislationassigoestishmentigiousqualitagrarianusticetipor ȆArealm.otew+coufirstrvigourthich paired+hadeenrhejudgUw dvahost*郲ry,yragcarryingrough:submiAlabamalaim@o0bitr.t)more,ookfromЏAe,smp@sam*achievesA`likRiresulff[pg 539]

Asèedalwayh(hnڴm.tRpilXbr0yurPgo0safeɗ.p>HKx(4lHQ`д.h0Bwh@ؿgifiQpл`cepύ8lIwXu|Xld ;sXmt8.bdD0aeliriwo0Е` brerma`rmaupnb,xehܧ0cQcapbwvebhpicBMr.ladst'@spȳhvopn҇beyoxA9%ofrshHڬrlass Zi) l0inciPoHcnia hxyIshppliXthZЭbjexLscp1;2 ipeoў@hstalJh.əiyY`him`xunػwhXqa*gettnyddflrnىѻraolu2attempRdȚ`ink꽺1ha(Ao8memb:sӈGeoaLewsai׵a yaffa`@beauHmAɭa)dcQȊHelbapronFtho rn@ixtisf)2@fbelpɅy. M n usX`talkAXtTGA;al8әؽЁT̃@eɥHҺoilZh`i9zru ŵYfeill@P&Tto࿐sgroഘ1876,Vmehoجp;ɂߨOP!ѝmozKu#,[h3>IIXIllXگ'toooo tl`ʠmutCpopu.ȽPrgserv)muzzlRrriɘ]qadmirk[pg 540]haredisoliticaliberalism,ustshurchmenatchwithneasinessnduspicionradalliances.eerhosehoereirst,o'Qint@stskeets,ould0mprehepPqof`ateemxin1atibleȅbecauyTnotwryometimesنPirllo8umoursoubtcerity.r.ladstonneverfay 1850,eyraiddisabt; contrary Pmucho1pls9G@:g1fa.etDŽ?8e@onwix?8ha+logicnougho1xaan yhfervbeliюanglnstitutcthinkaX dHonyxeadsav@priple9frkzte.

IuriousC]ygmade u8actliv@tokepߌimpPRWٚēimagin) miXjse(a.e`ok ! HaecisfromoКviewywhiчighregard(bpeop.welme,BmisҐIonslYroywarranafHajui mittev0bSotavfePrgivY8ishأY𣁞aquZesk;ȤڐPw ;{struputp iH@t(tain yȌ[Xag πʃЀǃer@x.Ȫ򈸰ary,A$@L(rsu)ans;zpѮ؀ۂQ1?ˆ8x8ix!ontgAjgparzcIay,Ҧ8i mompo80.<ilepos=0001392986 id="H(f_318">Atp(CPX <:[pg 542]c`beo0eashanself.%i:frȑmKlour8#m(hig8low,esby0ianpGreekRop0c8disseanpeak@unda,perhapQt (yel(e.fuea(embHjunis,seav(atimeo𗨕Pconstitu8sys@Д8IuldQvey mӋȂ9idBAnatؗ"(,wngaexpxiswablhqu0s1hDhnumen,ȒxiPךJKr.ЋIh priypw\Isay{nscyieldegО𞑟ЏsaronSQ @le (YsfeP)𖄜(soiculari%DBoQsnd:QsecfrdxAgYHmon Xtrc,atmospbroْhXod+WKt`fdsٍhe;@ l1drap"jhe)iѶ㡘pmYo؝:m€mamʯxz@iI.·xIpfulٰ`rptJ3ȲbIȷhI׸xa(excep)]feeٽpwa0sXPhazCQTrut@+̼XduȢDjo f±ƕ"AdcUhophai:}"@Zd,鎙bHh+wist./div`p>YP뇲yistakXfervxгsoront:Y*otChtomHknowh;䄑8Ыxy|demnP{Toл;sPqynf8jealhoX9иjhosit9tapthiviWoX}fd{oHofߔ[pg 543]5a/TaJunitadmjqu8becircumX deg2@h8dePʶҶКߚڛCh3IVbubble-schemes,oadaeaml5(apqiculahesis)Mr.ladn8`1lleduc)depos,zgxt`hi9danger.

H)wrotZLordc (1889)Ϙ TMoHchgisl:ۦ>cNI ink$azmportzrgʰhaolH0gd`ru𕦡 H§ext:JImuf8y(aw rawnЬorٙmmatqno2xmyogfinlyLm@IeeplsoIa0rX圆Bas:.ϮଐopXionCmXv 諘evitcipic( shҡQry;[IH@skecauIli(;dmxA:∶exa$ɚJ[ xs Ȼ):ȺɁ8lot;Ѱૹ ihH}publPmuhIPpP؄ ɶApvirnIAʡӁworkYtemp]{Ih齂ieAsaw0]lnCr*probabil/9A2un mis1mesyseHzays:ɶphIliadnQbȗerҺx۫ B`h¢u2o鹈nxd`onsbtineedeȜexJperЯ8ividuba9hor.pl=0001393092 id="Xf_319"Xa>ƿ!sano9man9triHYcrcYschoXR?ٶthvolwenJusͰi5#ڵPr T,d"a htl 8i뛈lepo,1692020> xrapxma0ץпresulunwiaxlox2rYiټ[pg 545]&/xכfize="-1">OnXeȇᇤZyheyoeansithout9instቸirwn,hatevereyink$on;"8epshisiawrhdisAuishedromolemics,Hb"eeents.ȉerhapsothHanyw PsssessrbeautBitsp@`relaI4hum`foqlscapp

Noeibeګيwork\laPÞJ V(nismPcigٚfollowYtIEue.԰hknowledgS##盙wth8inAixt螐emruenq;ZservpBhdngl`qͰ#[pg 546]Ma/>er,y( cepbfamyr P!ascienc P@(ny(hhunwelȫomȀbefswsPpxt.ףaid荰`,Ϟəpl@䲦csy,!rH9ꃁXtioh@nHsu goodI.ekvolv!jcl@;ne0˯ҽHѹ)wayyIX.ӑcharg1840C lixۯ0s.tڦyupi obscP"aP.o2doubqHbo!Xtru `haڞsulZa l-mePfeXortHfX)dа|n` bei?jgen1 .ϻ˼qPed(g0xirXlrahiftaiexaq lHoplWhyྰ Habuas ;@y!yq0waHs?adyinkwiSwenbeЏuPQ nYcorly.…{ظXpophalfဉ;ak{Y({suitewpѾs *tṶ̏ʷn.Ц邓(x龩wPhkf×doow T8mȆYduhursjugglerhckˡ⸸ ;w`sip8pkeepb)suscrs׻x6`TennyAYMaca8hexchacutdiiminng,HimJ(9Xieholemc Һ񱐳h(hap3Q`J.Youa yP(remark,Ach,afrlconxdiciڧtselfHembH!(#t1825.\:0Ihiin3influл1A-opinIʑligiympie8Y`amo38HPyدavoidp1upaihҹ [pg 547]\ saynheseoints.oennysMr.ladstoneelievedimselfoavennjust,specially"assagesf <*Mauddevothiwar-frenzy,ndh(camereprarticleadmit:hathadotufficientrememberGsalingithramaЄimaginx@composition.Xsfrank8saidኼ,troЊTfaculti[buterhaps=;YMprpmuchoryplcsAn .σqiiece9retract0C0eru|,LNobodyable-mindwoulx!dV433>ו҃CmostikeؕchosЖ8cords quȇra`racan.n呸case,tX`affecȘgQjineexpressJoveryep1convicњ:ie,,Patrlwey QhPnotidorammon-ship҇(bXuYXalvils:

H-)ss8r2^Β>..n>Stillhaѭn0gbenٷelвx rdid ɼ9(vita @racXسQ+,1so0thHg+p i8ara8amoirreg ƭr r"XycI0gbremark*hiЈ(poi @nom*)!hciXathE:f,m@y0ceivY Ksc 0pثӳHxma,dct1Zvi@n mQ20ughtsntendedltimatelyoraste Hidestruction.venpartromheactHatrusps, <:ipsoRoĀ,veryulfublicrift,nd soaponxyselfusi reasuryhichmakespunboucalls,hreeg0teeder#@lupgoldwextessenccommerce,ougzhadxphnccasxalesettingiI,0w,i؈9is;ꌙregulhŊeahame0+莈0witham8piraІ 2apidhXsrhipricHbrxlwayroduohaden򆠇ȈraŒrXe`hap#findaew-fieldqanyelse./p/divp>Mmarka e@woPieneopdi (1850) e8alipoe(whophilosophy[pg 549]a/̄Transl"sФ'8 ɯ۔zis:m...tedful!xrwr,lشoP`judg1 -cs.κe` bgotszYsca#TϳX8h aRledgJsltimhYrzncidq:de@)caXPбQȁzz2ironcҼncupwp>hڮ@jcCol؇0ʌdiffichЅjz}mugl1c8ou/rigin`epb7ĉowccord.ƒ0 eyH߸fȼcȞPjyGk $:<fesh@Hf.ȻbesIlEaffairЋ ɔastqPذnood.'bܿhA)ؤren)Manzonæi(Nap0on;inste:sC7kFAlp:ar Py`0&灷ҮؿosanargHs8ghtYlashetold7 erbolaar! ToĸScahиyoNoxSxhH.[pg 550]v/7A*slory?f-?kJdxAm.owߎ W9MAykbh/sh,hlannoY_\vнCW h2;@hr/'Ӯshipwreck:8erelqwpppchxg=,'hʻ@ⷀceTdiIt? vai)eagXeye;Sostrieao;CamelgYڒP On>Howftenidisen
<1AlPset r0mbPYliaryfXpar&QISfeturu؞ibe. nodp8manyookus;relievRanxiety lakKthirinYectucuriosity.ҝ*him@sfu(vigabiSommu2Qm(spirikiQvivifyQni).saP*ēion unjK:a8rgraaelsewhy쑘ˎj)pmethodical,yXm9,*p[pg 551]]a/h3tVBe@spdithbelieatfreblePing;(ean groveڇ@,Kwtohuffthroughscan,uleva9loftyestiny. s[pg 553]a/h1$AppendixIrishoNJ(rnmen`1883. (P@ 103)gd2Fp\Mr.ladstLordranville/>Cannes,an. 22ċTodayɓbeooddistressbypassreporіHar`g's 8y ospeech,whicham ss9accousoaroestrlXinxio(,hawkwapz؁0imatiqseem convey.pfelyIultPrwihngrap8oou!cip 8subject.—PIYdntHؙow,`Iə`immediificeedful,wfroms9has(lyؠlealtoge٤)@؋Iodtoucal)(attePr(icre1Xnsomyself}inkYȧ hlyssi!)ˤqXhxwIn rlȢLTTimesp'qDaiNewO2makemڃ,ameщ،, Zr0abeyanceYeXclarRtmaab ٍex g@rșXePHIre@dfir@opIuniەt`busi0rli0w(miWYn"2ȵPe mo;h@ParsuHCorpAySih hn2i:ŚIn`eٽ9pdٽagi(Q8)dX#pursuХ0meJcitoȦrse.anyMcoadjuhll)viciou(m0bRrӡX(ce)ѾUl rxxsh@maЛPPbi becayBiggP&.hoBr n0?>T l!mИviewn1pof@tivnRjudgrequٳBU`Kdmoꯠ쾀 zqu`!@s!highcralpymy,amb:*pbefQ@o@ll-organr0 0c duWrury;ff"(:(hrievXonp#dr 9artys؞ppolhpzembarrassa宴[pg 554]a/pas1حr`r's'tl rerloahmub8qkenagefXehemiпQaonei ngzB①t!AH9bѺor8poQpu`Ir9bodpeyact"itsw`ٔ5QERIi[p¯Qgogg(DirsȣcuAl ú߼Yb̼Gb(uj "noa.ybmeI Ĺ` BofPcqY!́Zcus0n>lx`edarguj`Yytruxsyitu `ymph0Ӑ8rvopfMeli0y}fin8rip KormunprJn𡈾0Xametrؼ0brokenownohirty-fiverophatouldabeaaX,hisyliament,fixMhomeulers,n4thusrrested (p0theeryeastostponed)perilocrisihwhichoansetookeace;ځÁwilliselargeunimajoriIhemb@edfundalhan legislatyreIonsAtwoountries.(conveyyyouwpare퀸houghtXn(ic2(imp8antubject.

GenerGordon'snstru3. (P( 153)<2cw)nonaslsobe8gaismhDigna,hichoulpe9eoad;utordolseley'Q0dorӅWpplialikea twoilitaryternatives\hlbeabinet.%/p> ObjqSoudD鎐ayqem(fКAiaHcircumPsghow1. seoH0whG@phehimxfo9honour//n>2possib f xis" 0erlyovЙZ@n>3.heck]slraden>4XrisСn>AgBy[involvIabo.arhe {.p(2 )@ hgx,xi` r`XEgypkEfo;briumpha茸Ӳ4Mahdi;Xa,bm؍8yriou񭑴h0$passsiū(. 5),rownЖP,к(8l,pyalinxbrouɀhoiew. W4n`sufficiP ut2popuнԱ^felyYȚsryx*acct;9ԳHg(um(k8armssEbeyEokJaf(enemy+admiit. h5qtid8anarchϲxdoß{wors±,praurki0ruler. I{XbeliнХ0/輑alusLs @OrȊfailuqfEwiresp(]f򄧄Τ"0fur¾Ymidaxteع$plaav`urȯzrm.‚Ǟpledj(eNun j:7s?10ox7HickJR@ePfiيn'mْsa2!happ0H£gsupjP fulIpжʝVpo?êه1k8Ԣshcapac?>WBru1ItueЭ(޲v5suchȽǴȟ:o1m)@can[mpletedisHf3Xob8pTEdж٧cmaydYNiyediؽLi*firluIf"iZSouȯ٦mmeourlit VVnz@flicxְZ [pg 557]a/l3Nat-ilim8+hl`{remails8`ifu8coichhallt.Ǖ>SideaJrocYoo wКbSuaki w)jfQisiгHadop9Ys`ubs0!Reрdvancenhartoum.herosecutioftsivilrommercialnterpriseouldePnew)posal,oexaminedyits 8.

i2estse 1815,߂?>yݢhhallemاȬ crtα[)Palsoa1a of@twtwothree8ppwaX8absHɸr `c9HwithefoXsIsuc(mea`idoubtoNPoicmu"@m@WWR@r8,wequI񺂾88ma@jd14sAfo鳢7iPgara2ig?9gtgyp`jufiS1on8ol|y,!hink,оجحiew.r,/*Gon9r@alecHer tsnЎGG>Wt쾰XmissЧl.ƺh!3ylwx9 ʃ%menXK@iegfinyrayXbXдroop8slaughq:8whء sf.w0frag-d. bdvaгxewYidhladԠLlirauxHAx fn>I\̵`чiړ9[pg 558]/be*waB`pknenPµphrop=@rط yuằxutdoȱhaHfhanӛ0ahr](tȤВГ聈dhнٻ䂀d9i\lίٺned;Kk9rygga327 #XπAsars8mids1snconsistencie tructionanepGordon'sanguagXisoheffectXa):aopula`orcettachhim,hich HcouldtemovXwleave߈߈4028߈99|BDeoetlogdigarhJalmpracaBctuallyettingboj.hyprosecutepye؍moromafP/arri !my(ry.ɍbysulnowei"titlshrnor-generxmightatuphintrib`in:lmuxsӏsavourQlrevacu , `pAsq RSoudan;50ӆvollykstill̖MahdiƝ ept9hBondtHK XωŐoc!anwhpb؇*declarpolico-invepwith)i ap npiPEgyФIĆalike?ׅ_horIqssociarkHick8sel@b8laҢ:?t(born`o < grȦmp؈@e(ٓTurkؤ jBrite`oyfob\annou Sa timIntradictoview(8sfeelϩny@ر@PYouت"s.ԬB ymp[ we`sigl@˵ncr1xcIomry;Hrso,z`duruiXBUp Ȋs?Gاhapseb`ەcein0(curr(1lHȰX$miss㵒rkһBdegregXPnT.sV/p> sXHoXRuB, 1886. (P 308)

Fuʇg0Ux3 sym!=4B;|]dur[oqiPr਴appt)ad,ov"In8)dpc(keepЄ{figavailin"tHoreceiptNexБr8,350,000, cpom@hismp-taxcnonivenuOXen`i)Uax"lGѰ⸂1Pmojܕty~ϖdebaor*duPsm'sXimpurpossucHUdebciv,je-fifnthLJLupA3,242.Ã rput 2,51,rpay򿘓n83hcagrob1,4CPougaid߀ZrXi0ʮiumwky,rpobaccoHduc3,@avxtri,0mQ'n>Ar輐uHr 8btygo߱:a0ٶp0wew .ד%hself-rဆnmentereoupledroposalsorettleBofheanduestion.Ԁground-workasnpfdolordsibeingoughut er"term"Act;purchas )beYIrishtatxuthority, xorgxrepresp2egislativedyKoccupibecomxrietor, <:[pg 561]exceptncongdistricts,h኱ꋋnormalhiceowyears'~net@ntalmosmporta8vis,onense(RaHhichXcognisalutaryinci(kublicithouldtɌxȐۑHsuؓxcaislyRbenefHHaimiqnumbexȒculaX&soilxiHany0HXdvaggover˖PǑĐmunlargeepcbyaketen annuinl , dY2rosq9i?>$eritreasua cч8geǙCpock(1dincYm򜤞t 18 .sum9ab1sellA.ow3l 9SsecuX?ГK0ities0is8oa irold Hi@ks0sf,I!reven I.w(`collsonppoinL,⩀piœQ9ca`bPBrtyaehr-g0r#ghimbdLJDžsi(*lh1 Џu0юog0heHIe؎d.}/pH/div?kmbp:pb8kh2On*PlahO (P415)F󺑨1ia9PaxHCaesam+*up advocpliber@"Nya̗[ydv00soHl wl~иģRnKmisp (wybackpgrful i)Alppp8dowSicHmor 1÷񞚮lurPxhxt'(esih, [pg 562]ar1f0ȼЁQeloeevd8m=٬muamb a,Pnow0xrurdufl8i(erhapٗ!tȿtooq J*ap*vo9xfoKqdo8tfȖHrglowced̲qv` u1nBbehalf.7i>

Afterescribingheastistoryfrelandse)fororepaniveundredears 'onelmoHunbrokenuccessionpolitical Am swollPtempest,xcepthhosseIaimenPrupt(byperiodservitud0)stillndeath,'r.lad؆wentnTsመiHtroXcontrYwithfuture,pres(.ԋdAIrishijufiessanipat.teXlsoyapauulegehancipaganismi@t׀,m@`manysal@foul,alsoo`z twoacedioknowsÔٓPuxonod (irifDYa0arAHaҗxAupBRzmaginHpeopl8enllyqs;`aoughtdhip QeasbePposs!ڝcrew3l(icxro7vilaagivplh٠Hpair,i:nghPa!isapped,radu0ptbutffectۅlouPdiswaba(to@bpowell9PBurfdeep,!mHإBq)bePuproa0safetȁOOJdangex nd(neficinflue odS(a3I!r| wpliberparc tPma1886y[+rhcwreliabo`qcar0war:Pho7lw XqL̖oe!quity YduؚѕA=lo`owU"irfrȱڄ`Yfcg)ho29ru6,ɥ(nnoXayttw:)awnhabit ɫgiqsfHЪS൉hopjoyCimiPie8ub( b࿸oY@ͮhin(asx,Y@raburdsolumX3rhexhiHho0engh aD [pg 563]

\ #S2approx2(nOn>chargevoliplanadmiralȊ`4,240,000,ay 4-.eing8c`p(subject babЍ0som@urr_becom)??>1.υTormalavyF88-9 (Hi.eLbefoȔNav0Def(e,Yrounumb,hv>2fir(year't8|ǃt(1,979 ), 23V6laܜ093-94a3ה4o("5711ϗoo>56high0mpt 8rfray=\r0nu2-3OO"6OLexpit81anys׏whilud81,1529borrowm y, 35' /div?[pg 564]ea/`;mbp:page*/>Mr.ladstPCabtä(PP 525xMStaywXRipOrلroulbur9Knatchbulܖ`Epnougw2.erHWnveӪOPol#52-5Cwo8Ol׉jrgyBPalClaxhooѐoMoansdownߋussir׆anm8arLjm9-6iampbLewisoPDukꋧW>MilnGibsoElgiVwrdwǙestξIAl/m65-6tgosch8-7xHaǖiawrucOhi?ñגDFescuߝ5sfelel_  80-8Sccou׮:NbrookGJaaWod4ilkŸOTlyavoseإGpPBanXmùQllaJohno/92.squiO

March 19.tavidson'sainsnndictmentfheovernlkeithiandlass0terestsσ20Juniperreen,atalHo,epliesoryriticismliberalarty:Midcaldabridgrightfylia2g2bGilmert(chu9dis ablishLoanheadeas`nolicylzY/c3oreeEPath5PenicuikiCypru'3#StowfinanceApril Religio Achaia Sem,Feb. HBrHclosure_jFjetownStre1ئkvndol᫰ssHAlrIcgyaidIndiaexXAfgh7cQytstaӿ߿ڕ8wOLLawߢ׿262Ϡls аshзȎtMuseu_PS0 selS C9߼T@98milirҒR7TribuPLBeahsfiel幰gesOblнHyi{Ao^v[1Ȝq8"i/υϨoУM8HxfifHonths'dmiɽ?TParnellHѡexecvOc0PPXwithd yXrLeeds:Nfairade.تuHOldH hambHmercef$0m025,000L"'' 1(/iϩGuildh϶hr(xfw+8Knowsleaim/WP/cy*parliaAprocedw882wq1Hapgricultϸ3Opdeputfrom㏂rsfgriculture.

Feb. 7.nr.radlaugh'slaimOI9Jhomeulemend toddress߂16therishemandorGwq20.ovesirstnewrocedڃ?1localaxation/ 22ooas;MeetingliberpartytownStr0HouseQLords'ommitteeinquiin`cLQActwΈxoluYxralitaryA`juriptet"good(vernFMarch 3JpersecÑJewsussiaSupporlegislR Džoath_1ȃroposedtat csiu3railwayoSBrx`Nhorneoompanyh erreH/T;graDukAlbclos⎞s>[pg 567]AprilspmoreleCetePoρ8diplompcjunxsiVaO24.ntroduc0budgρ"ǘgAbillay Sfpolicy,nounsuspects,bxignf Fo烺xߣ?adjou+ nssiס.av9!urkw)159ArrearRA(I)έoadPre}CriG75Ս756-June dzEgyptiax&ci߂ghJulbombarexprs|thiWׁAskvocreditb2,300,000ORConcluddeb˸expǠug.ilf'4nmem s, _a1RsFwaO 25-31decwelveewu(鱘ced Sthan(xengag`oaPȼNov9\demٷ1sX_hPa_>k`C8br(s*cjue1883h 6-iSuffHrompsn taxdeҹLe(ngA#ou@XFc.ؑ诨hL?թWxw (1)BoervaBechua𰸶CPu9in9@ooggnotaxﺇ$hbWolYyHuityǨarlitaOathx艘66''@tΞLi bٮserv legacy1(0workladminist0,J-̪S@tagi0is"reHmTJXMeet mpar(eп fice:sɟbubuDzAStaf@d:ribuGa`aldiH@pu1claڍ@owithdrlc)gree SuezX߯aapay淏'7 30fuagos򃧑o(n#?8TsvaY@Zuluie-toccuprqXPrxsagainstiol 071lthesٿSetalCowperhymn: HaHmyl!عq, [pg 568]Sept. 18.ntertainshemperorndaress)Russia,K1QueenDenmark,tinnernoardDec. 22.tawpenoeputati(liberwork mneformfrancXp>1884^Jan. 5WPcondȃCagricul/ 31.eceiv)someedsIference,tc., FillFeb12Onr.radlaugh's@temptataoath'"؁EgyptiHSoudcyreplyvot(s}3Bre-establish8tgdPmmiesGA2MoђXolutkoperretirezxplprovisZeqΖPeople (f)oIMarch Inf Suaȁ6grnYN'"10-19.nfinedARo(by 79April 7:uatx`Cbear؆de"uxAlbanێGeТ Gordon8miP8Áse9agϖϋbyojhgh/)G2@iaffairJunepposidǛ tsuf8gxoh82#xmei r8߁{thiW̤GޡMe(ѩ=party:jec5oHou؃rdnegoا{2a(irEightylublֶpǮuugʐl&/jNorthok)73`Corx,Ÿburghj߂WWWѥadministȂR(Wapley kem4 s];Re@Oc٨CuttoWir)rwac HerK??D ڲp(r IhNov. 4.ayundstoпhN"hLEshal*6]2sMrbouchXremϝϾHDecBr8sReXtribρuρϿ1885XhMficưeϹAnncocPenjdehRu@anIGLo8NAAskC.r@tڙre G)Afg8BϴWR{Q ryputUspan>[pg 569]8@WaldIrel,!eH,jfdWμDalkei"԰竊XuguICrosshzXȒhKc!2tusic77(tactic Parnell'sharges.

Nov. 27.lectedoridlothian:r.ladstone, 7879;Dalrympl32481886Jan. Proemoenesis:leaaairrial,Sept=L $Tena`lief (/OcHaw0eRecex/!400,000ndϾ+[pg 570]Contemporaߪ׆ܲ[Swansea,Welality,gvan,ֺc/O6hletAbble"@A0Ciffloon3n2OONDurhamALordartington'srishecord.

June 7.ovesjectionfCriminalawmend till/)9.resedtollisȁHithddsignby 10,689itizensNework 14.nndad!theLaЄ6.ta1iberpclub: HIrelفhomeulexBincotWales2ЃMemoriHHahsobye-elAug. Mr.eckyjPolcMoity,߃ѽan.favouJeqisɸdeadKl*roXtdӻgeCountyWt ()ύyRotlsxe,Batt@BeliefMglo);ChtianOOHo(nog trofIladneib 7bbook׃٪MemQӺqu`0'emحusafWWWRece`sput1500̫ashir"gu0KXGermorǁaIad;c`ialawChanTu:Ompaddbye-elecJuxGizab8Sea⼈Rg? 9aymem?j ToE%2juCPPar@ommis!rn߈GMCǧwM)Mϥesediir pitrif0yeamardfeǍіɴsi?=Wug(''nservveg_OҞGpadeusbȢaculfruiSeptދ!ForHr,WWW4Wrexham߽Wel homeultbE(eddfoEnghe(oIsaleNovQuChu@?W Town,irg,unгQeeot@`قabI`#

Nov. 7.tingleyall,prmham,nrishuestion.

8.oeputafmNallubgrievances19.σLandurchaseillDec. 3bMr.alfour'sdistrIrelH߁15LimehouTownnesaryňreformtheLjǂ occupSuakiOkLeavesppl>1889Jan. Daniel'Conne(ch 1conciliatomeasur؆h?23deaJohnrightAprilZFRQ/////421,000!rnav0defe72Scot homeul-*[pg 572]
Phnici8Aff úhca2{HawHtage hfruit өC|goaFSepؼ`E0rt`[PaqSocietPfolcEomy7223'$dock XikbimemNov/ChuiundHenE9hW~QuDDivorceh0n׿HDecMemoriaerp@+FTɬ,Mˬ:Xis\pc/Inǂýgrnrywϲ[lPheXxTownci;'18907an~Aefe)ȇwߝWelپPG:scPersons77777U9Ϩ̼`ecZqϹ߈ ϲ'Feb. xOx dvgSAssynythologȽZ11X8ozdeclpub+CTsMorg8nelettoereayfrivileg_PBook۾Hous2f Hm߾߾߾߾߃XrekLcommiss2N Lclub҂___XP`GuHospimedprofeOBxlJse daIasZLand (Ireland)ill.

May 2.nisestablishmentfhurchQScotρ1freeradetrince'sall,iccady5LocalaxationutiesN6.torwinarnellommiss, asXhlicensinguφ7Lowofniberian [pg 573](rociRthgriculturxlabourer.April 2pReceiv10,000palHtwarden:MitchelwIṙ,LJune Chan0u:ρ=13777G{8.oepositorsnailways'avXanks2thriftulBurltchooXLondAeducPwo'I24Anglo-GermAg`730WesleyanN”LKlubalte0marpgelug. 212E9tgҔI!fruitarm؍υ-Dr.l1erPosthumous8mains,A9Speaker^Sept.XDirworksindustlro@ss6OcІCornx(,dinburghgovernad0iПalderndrk clasgalkeit*huleorMusicretДmems,crob`uc69undvMcKin(afp8icArtǪeryrapprecivbeautNovMCgi)Gosp`WehبNinhðury׃zLett to 9Mor)qXehrshipOpar>Dec`urepܯ0ifTeople_Y#Pr{Ret?=ѓ'causϲKT0Im8gn eockHoScripe<P:iclȌGoodׄs7Y؞уmctudy,ger9PEsshPoContacPetwBAssyT)@ %Texk1891anKSupporXmo⑨expuhom ІjBhlaughsolp(1881)FebNProsHuxSw-Miraoחחת=@Mse١0agReligiDisaovυrlibraryASMQn`e7rb6Xemibexec@v8pippH ϊ:2ȻHdit记chWa¿Ptax>0pg&8mGB1xEtCo༨HemiHangB cheIfinanc@,olic Ucaf?ymA͎iZJohurray~˾MagazGune 1;Jamesxatuh!lonBXocsƲؼjdevelopfeuDeaP.ȉ ladnOJ1;HawardiftyearzHgȔoSep`Ele1FNo.II.׳׳׳׳׿նԓYnciBefaatO氋 emA9nanichOI(Newc(聺grammݾ[pg 574]a/`lo self-grnRdy8jWilƕCunHhoaponJit-sh𨈿cooYoborn`urafereP3beyЁ(l`LeaLȩy(Biarritzv2ϱ-ϒOlympɮnxhjRview 2Re@Ǩƹ {20,000:surv`Ugpaailway(Onelshandenureill.

March 24.nmallgriculturaloldings28Indianouncilsct (1861)mend tAprileviews Thelatform,tsise ProgressDec. PPP`wIfHdL1pool₇ϵM@ pna:qLea1EngBiarritz1893 1@۲ /!))Balfcic0{NFebJLreadfavevacuvUgPaZ[pg 575]

June 28.ovesesolutionorlosingebate committeetagfomeuleill.ly 12.nnouncg rnment'scisIregard9thet IrishemberstestminsterOJ4add0scongratulanarriDukYork21new8auseogbقfinancias^Aug. 5PtgriculturPHall,sl ton, industryndrt/)30UthirdaҌ?? Sept. 27E8burghYHoLord HNov. 9.natabel8chheredpanyNDec. 1navpolicyᏑ1894Oan3.ea!Engҕ BitzFebh0Re n@oMarch `'d遪PaCilsResig1premi@hip_ZCon(b(byepol߄܍sBrighћr SirohnwanhisarewepparliItalifeay Tvedracefispȝ s,

Aug. 2.tawardenorticulturalhownmall eNov6.eavesnglandorannes^1898Jan. 5. PersonpRecollectionsfrthur.llam,<ml:g="en"height="4emhr I6h1> Footnotes1Patd>Ab,ol.i.p863-р028182_25-8188w/131424/_3">3/*Bradlaugh,hoasittleahis kill,undedclaimp Evicemend tct,akHcoXi`Parliaiaryϕ8octى_22897e_4">4_ZSPC83'߉732'e_5">5߂peeY( dq1ffirma bz0_a42689__6">6_ZLordmp'siarig 56`7">7gbhapb0quivalbegeit͌sdaPnici?9157_8">d>Lucretius,64ȮFanaѳgodsuiitselfnjoyeupreme`rodlesHim`fardrawRoy(s;ph`πeril0strores@c+wn,eennov`ػms.wy52958w_9">9wrReligiousait( ؗS49ǩ~45700VƼgf63811g_1iwiratoleyMickseacHNov!79o'5233'_1p13In.C,an1ǰ76765_11נnTX@Scotdȳ48, 6o819h1'{258No. ߂w71ت14r.raPDuffhcol@r-aidH(ComMay0,eU!xyicultircumsta0cas` p`i(seXdxkelyÑqat1ntУBoerTiP*nglishopulZth 1Tsvahoul ce,lp0ptitudporػhfe`$ largsib8measDloc0libc bed#ZeMaj`y`saadvis؜//86/01?;At»Hhamxune_oo007246oX1367,ZQ__s94wȵ1׾on>Af(nppS.frica:Aeth9zladstobyBartFr(.urraXP24-,Hur@o"hѕmoImAs𘲜o闃nPtysdi֔Hsї orwwŐʸu. (KLifegS408.)OO|396жP1__Geo8lILordim`corpoIrea0Btgrieve`ncryo.ԌafRhaPak(armepY5696_22Befgrnmicamo,tweHAuguhAprillHGeneralolseleyasnommand,heorceNat`Transvahadeeneducehyixatteriesfrtilleryree!panengineers,navalrygiment, valioninfantfivmPervicorps.Ԇatt YoutbreakA:1772#1759aoه83531.soon pnew"qinsurrect(achLondon,arge8ȋserjon8despattoo8irs(Jmeavingibtarec. 27, 1880.

21a>td>Sir.radQAugup1[sa 8ornglASeptember 15. HerculRobXhipuccessor,id CapeneJanua `IinbGeoyStrahanagovernor''%8310'_22 2'"Lordijifiᆩdecis9PIgrouitcmsibl@oXaiPr1inqui!r0raohourarribesiege8weJcct0noroop oliꁄɐe󗚆RdetHjT94thcufMmarfromydengyPretoria. <0n>Iptrprٔ yertain,dz̝sBrighxm0! vffpspeتfoiIHҝA۫ b P ڼصegotiarranK#viewp'''883'_25 5'>Lif:,i.𿐌ggB73ga6`6gbSletڎ,eb 3wwww093264_277SeelbornecMeialȦls ew廠Newcastl@Nov. 14199777707_280872Ii̾Edinburgh (Sept@j4),Gladst𸰫:a arguq`opTsva)f`nua8qclPjsngympathHIir(hr lhu0relig.hgtӀ(hfr0p,arttisubkhm`assocPXix5χχɩhaXrhdon)aPmpaghsPowestУ2erH/(q4uBAfgahave whom@EDutpopulZis驙rm|us77793927_2907d>Ju`25j54e_30">30OȕmȸX@enem*gonrxyhyea(ٱJvo?8,㺰ghiHH.{s`(von`wrСKRxolph(urcH0'QbeXexa`Qary0unjusfal@rbitrarylic8ursuwardfr2FrH,hepLanyo`Jinariumphfheritishrms,ainlyruteorce,ouldaveermanent8anopelessylienatedtromreat.nwholIi myselfeeoonf,withouteluctancadmit,1Engl1escaparetchQdiscred`bleuddnot&h([amagbȇhapsbesossi2anner.
31.<*Ipprehendhe8rouallar(ctorx,r`Suzertyrecognony)asaramountoweraxactsaerɌtrolling؁p!ؑhhsticHxerciseas0righoeynyegotiaii@S)deph$may 1eigns.אevea`,ConvP0oria# ngsimp(dXiXres;Е)gkworsҊupoyeeKkepsubЖȅȀa:usтbecause1w`legalЏҚ;eem HbP{qlike8lea2mopBuxrdLDer8Host,ar`17, 1884.dodesirjmultippos{sXA-r 8gho7q1897-9sIztwofo`rkamstruck Pw'wn@ɨC3KnutsȤbRip8ئcoloniHoffians+giCommpr8iiItXnlaimwcxpPwardooj6613o_32h2oo>WorkT..eniii. 38ѩǩǩ80_33ǩˆ,pril 4‚475_344E burgh,ӝ. 1{11457_35x5zSxvol.@.ookcpPIo3429o_36h6ojcexhPbж(tн SDubragarnehosi`!spiHy.Ծjury un)g0rdict4_377 Tr雥SW`7@successfuladisturb zq1mptH(iP(Ͽ779327_380872Fzp8sXQcri3Co1A0ĠawFp243-Y2389997GF3970Ge_40">40GBA3Cl@ȹh `quet,̖hO 8"14043p1ppeeXa hؒ@_^51966__4X4_[IducMr.edX''3Ы'_44ς̗'Burke0 drhromast@kat8`8e(Iwalkomlow(te0ves.Ͽ)iccasfou)gchiehecreypas蹳d=Iata(him{d  usuaIB,whaءPF969זXH4OhifzDeanurchO@9ߺߺ65414Ϻn>Nin enC0AugusP7;$Glqv"359gg856g `4gcJu(27ww988(4/sGranvil MalYN*G70421_4(4/Beeidian@, Gladstonಫ7`awmpontinpon:tITcapʳh ishgooj-proh`gnm`bi3Chr)pedoؘx0erimilarncapacityhenisaskhallnlyeooldmpireveropulationsolPoripyrientalsndahomedans.nYheadootnowaty dictfuilhasetPfoubyhcompetXribunal.<:Gleanings,v.. 364.
49a>td>FortnightReview^Ju(1882WWU4485W_50">50WRDefi1elaimsqEurop ondYonevenue8571_511ooi8353o2od>Lordranvill€DuffeБct. 5,׍׃h95333׍A1y#credisuccess hduadmirabefficcfr.hiP(WO1e.eeirarnet'settim, LifRUWiR117WWT99303W_54ٕWd>CXiateaostrXemenza:
attip s@8iq eruti,KMa0ser(rtuonosc.Innoxxv118204326_555>TimeDec. 875802_566>St ardNo16W''!6039'_57ЎY'%MorPȥN20gga7750g_58gd>TraNewucianp05-6,inpi`politics,bookwit,carship0eniouslaRmind}842g(x5oHazzool22wwp1654'e_6 6'woTaiWD0 "8748_6x6Bishoprownr ofd (. 457):|Gladstone,xoth(omsel(Ѐ؍0ch8inqpreced(sCommonweal`܁@sd@f0rimAмgоworkstyCSutxxoHCurl(IvreadP8DȆpt!y Wilberc(wanPalm@Ȋppohumn(pWin r)胐`was-two.thbcoultetngl(QJix8eI).׿ה9366L DChuȞ'w2242ǘP6316G6Yvol.d4.460x6n>GѺ28>6606LordrhadfusPo vRMay77 1`6g$ ؖt"hnompor8qIripXetiquQtnec ph hap¢mHio. 8a`lguarliy:68I㡘a(rmfiXYb(tPcabin詨bsul៱success᪺}sbsurdJqwhicPpiAsozs.ĥ"ir] Iؤ evnrn orlynce@ubliciՂyartial5aΎaѭ,spelidQDse8dȽe罏5553_688Appix43807_66lе|Lucrp(H eDAbill). abovh046729 >1ƿ??i668e_70">70?:IyynsH8to7hm*hwisxggrHꜨwPa8ڐ,is8wbch betweenheourthartyndirrontench.r.ladstoneadufferednpleasaexperienporase,frelationsroughtbouXyfusalqaoliticxpensftinquirxso2accuracy5necessa statemehwapplnt'sP0fot.
71a>td>B ddoincidIȋKdamelec9iset,ɉthatFr!rimeinis:M.ombes,aidowEnglXEdinburghugust 30ר93584_766Corxchang0OO00306597_777Din=Eiylub,u11_77@2660G080872Lordײr7?7466_799#l 758_80">80'>Im p!re,Fxrash s(Mar3),ParnAwihذyfy8yea 8l.л_88TwѤecpccasni)ٮIr!hAsdùR׬ה3116 8׬W`x551oo59GHBoeouda臐quZ1819IsmaPa,3MehtlifromKdaoHlesXn PCountry.Ƀ70ӱPSamuel¯rPdIequaiproviӸ3`_8"np Nov. 2:It9no%duZcuxu dȯq cpoXXlȔnec!0ii`yxcst;u!tXenilusp¿ouHperatٺkwe῰xHdiso m ox8lif +aysiity zGranv MXs3H.M.0wȂley,mavXIun(t8\au8r@~埿,appointxachGeHHicks߿ߡ9213_8x8۔amis!timesuȫwarrifЛ(dLePhdpy@massa d.tokar,taX=ldiсorpoX`vic(s.ee 5?6566?:^Bar, . ;ʜA1H340029_877x8yiPTaip H9CPa#634 r#?߳or-դtϩϺYAfrx%68ignow91rou0 withheovernor-generalfSoudanponBsuppressislaverade,utasppointed (1877)n,arfur,jequatori8provinces,ndZRSeait(al.eelisosittill{Ȇx@9,ng ratrohim3meanscommunicashroughoDŽsucceedXinstablishparorder.heKnewgyptimenteHsGon'licyult ysixears'orkoPfeoie.
88a>td>VLettBarn1885.̆ranv`ookticket,WolseleyarriДG{8bag'Dukfambridg opadoor5899`pPInuc* (JQ25r4)}4216_90">90{ladstonA, 211.IgraphhlastightHoncurreyourq(byK:CherXuwaXm؊only›morn.His((FyadiྰHļIZAtZhognxYa[alQbegaʷitth.epy8da11Tc8net`tcamicommunicpClarkvѽHhibiatt.eSy 12IB s8e13 Goʆ-ro趴even.ɏXahowr,akenongtIticleac`Ć+KpulHst ؘbyH`Saw.onclavP7-8-,elegram湰 (Џ([OOMOH1I1_ZcȽHnm*1orYs{0admp!Lxw pat0=Ͽ638422߼

Ilj0ceedcurious:rnubjeIannotmagineny@differingbout.ha0shehpolicPfnouncQourntentionovacuatehartoum.venfere ndadooshouldav`aid hNbeomHxknowngi)upbgame,Perya(illo!Mahdi.Ђorshiris)sunicultiesbenormouslypcreased, ndea!withdrawal1garpЋ0rexredzssible.I@rviewJenerXGordon, <2Pa`M)Gazette,a8, 1884.

...IHaf0nopPFeb. 13$ssemd 1nflu񆠊AqprovHdw0mZsetirӉdzdocubcauX犘txcite!,xi(itsurportasxcedid much ȎR.ɗZ@th*holeaЃ`resJHmeetbseqthriirG&HenWiam'sI[ifCHiGeorge|p. 340/dddt>(@a>td>W11700184ɂd>LȡHt)H(ommons,Hy(dmirpeech,*!bestefeѥ@minissʟ٤ψW807WP5Q5WRAddآselectMidlaSepb17҂A//406ߌ)6)6/*SeiHXoSoudCampaigbylxlAv(,ЭP 1.h45-9ǑO&596OH7I7OJrua2Z755588vCII Appix 4(27Qpfroauthorit Kitch,qlangua(knhimselokextremis,PDWߙU8789ߛ9ٌ)d> wata@nighuntruߟ85783_؞d>BxMagazin (NYork)890ƶxtransl=l r6fouxP[L'gy hsPPerdueecipi&.0-LoBey (28y196-7.ȼ豀chieȶ#stafz쫼ˣcular-hؿBUn8dt`s1AlexPria蠈bookx0ublishn ,iT e phets;ز8EHcAisha.urHvieqKtoumournalsAcademyVJune?gg9984g11gbovSo6668 >166/40`22kcepr288; insX30׸׃"207ט1׸IPte riг`puKpiKexplHxapusanimuould `h66311_ooEG1Gawr.ladБfe8ec7`L(dous(lrཙor I`yi(ʜIgr@ful`aoQg*advantya(Ahav9joyXwhH(rgdڂUminno0!Berlin.t97111OhWe ideR`anypXpoliclea/(:iisxnobȧagatarlۍDxod]imep u(uretȖYonlyicaro@a@rcost(0edi뷸AenormoHsacribloopaipXatinu 0tI Xnkkeop@ys.efЄ佐SuakHz`ae8iobc,@ewa٦onducȺq0𕘻@lwayhryassverromfricantosia.oothink0aYeetentionfuakinXfnydvantage HyEgyptianinmfwer2speakurelyk9po`viewY /'wnt8st,shoulday, AbandXDonce.

(a>td>AbH,ol.i.. 4943568Qd>Edin@gh7058319qd>IletYMr.right (JuH142)lreadyivenPGladstone(0somewnearQManch school,dxpsedagreeith%believingosarshaveen@`rrors2057_202d>Walder,ΚmbЋ5921511May 20w30544p2q2T8ryby.huillaepSheffield,ept 14033McCarthyHulDec. 15rٛwwq5924ga4a4wrDukjArgy{ooi61xoX5Yoh8:ah@r(36-440),$52+Disra(Pmoforma xdutypouxreject8 286g`alsofcaۯٛulsܰawhigsPeeOn؟341xfens'ebatpasdzaajori361irudgetroH9regayuPinis"ignh؂RotvXat"wconfidex ؙcarri__1 (312-311Ju(Z41.arliarXreup8!dissolHoo6oX6Y6o[emo.OH*eнȴypapyoo844oYi2oomindcolleaguྑwhXumoВquQux, HdioؙPoutqsultaBRfs. eexcP)Stanley,(pporhimWW95Q2WSwϿ7hϴq2co0snp1xTHRCommP0alisbumsWqBQnextayڄ8omitɦtwxsromfzle`rssav1hanyarɄlintx. A rel" Afgharontineg sRussiaoom7791o_130h30olH`ceed@unusupbmoaecet.MulgravȑPaddsA3pClarзHb50.œeaXIc"!vroyadr bAQob龑vigor@tacknob(yselyYpabl:makffipa!OOK80549O11Oȿ Hansb 298,. 165ǰǃz3GC2A2ǰ·M.ȋЋٗ1 9 0ϴχ4408ϔH3I3ϴʇ9׷׊532Q4Q4׃>Ibi11192193051Id>CXemReview,ctIj49ɾ7(3eeSphatorS. 2U 50585Ge_137">(.
Mr.hamberlainaseenoodnoughoeadhesewoetters,ndessentsQ(irubstantialccuracy,ithemurrernrorreeoi0,ustlybservingat`ybody`portaeryoaPvariedonsatiislmostert ,owecrupulous ؃؆ ,intplaceswerhpmuchh ownind,a@anordctualspoken.Ƀq㊷itay orxnontroyfhЉh@coctiveaPapdesiredxt>aurisE.gP181P199ϼϼ209366ϼLܽ338177φ3`33?5229?889?d>Augu24bIǿlj7503ǿ9ljaHartth0Wfoo}_^984/5050s#ǒ30375x1y1W,epbPoo2747o@2A2oo>Lifdii.23ǘdž"603Lj33ǘ… 8gGG8488G44GBNov. 9ם9295Midlianpeeches776te_156">(.
IbidȀb. 398t>Corppetwe 71Carnarvon,׎ֈrϬ594X2Y2>Hansؗ{30XpQ929-1994|eeCZR0olphuPillPadgȮw'89w!7'xwellLife1W.ȄmithJ 33pa7gIiseemsy`bollereadrP2an PHHaulay@di:|IanownۂIag!mohBurkworks.mirable!t@탸siaMil.UTrlyan߉ظ37oGm4`G!7dn33KػrepXڰaIrel@thmbesp`ex8fic parliaulXuusu`٭Tpos Hmay9necp0ػ9distur¶rc `زIrv streHh˽yislK8@itwo` riewhi"y9supporur*8sgdie(ovLI pdeteo0b螘QmeHmy˒ߔAddressnnswerssuredisajestyhatconfidencehouldoteisappointed,XdwyallQreadontrustYH.M.uchdditionaleaQs,tc.,orherving"strengthen@egislativenHhihadetermin0
(0a>td>Hp302,2840477Lordarnarvleftrelx:!bJ(ich(h ^.‰awyerseemJo蔽can\itHtXv(roօ7re(Hechnicy !kdom ( ),ptilAberde@swornupp105H cclRsig0ut 韡SPhhiefcretaryghcHhghadh rreHѤЍpolicyWWU62WR8QWWWW12WWT52093WP9Q9WRoftta`٪qg8%Aquțot9Xӂ)hrowagriculturlab!0boar0DT[*saiгonrue:ridA .ɪ,Z(b*Grey1830mheX iuD52 la.ƶ8my,hprsjdpubxclanfd`w)Jolljb. To*CPyffx16i90U8_1808DiGG6580G11GG>WkarfiSadiXChamlain'stireىheag؈us"rthbrook,Sel Dod,ar),Ԡlya Bright;ʹGranvillSh,i*e0Ri8xhChil(xLefevrIilke (unavaile)Sosc٬QXbabineڼ_61096X2YAd>AewXeks(RմBqo*ncy:bI쌐ackAn9߬yZp)@hiceRbyinfren0gfinPasde@i ivфwhaddrYelectoidhiaؾ8peesƈ 郤 fee:ݾnoȗycomp McȾ@y PEɜlubr5//3481/33///+4,0757274472JanuȺ؅lǃ85ϾϚ%6787ϩx5yϚ 0A(PbeQȡXn˜horu(ip!sp o8esglaXѸbecauocsoplHdopli@q2Hg𾡗jڣC٫oupp \,xwh0strenu` o؜ɻrercb(fXowA(involvaadicmisapȺP:natymagu0|c;Sxtroargu҅mselvewa lmuPfhne rD!crc.ithoua Qqadvantagefnyommunicationhateverithr.ladstonepIrishubjectsoromeearsee,adtillointeduto탙ntuenatewcastlenhereviousovember,Hreasothing/('sloralanifeimrom(opos)a(loniplanIreXd, d|exssX ownAvic„is!rightir@цwhich!look.ewayŇfaA8y rnmhadvoiexclus鎐mAWmi9qoduې@measuealQ!.SpeeЍXChelmsJanua7, 1886.
(a>tp>TcabinetJfin:p8ollows:FirstXr؊|rBýHxclchancor؃{PidcouncilOISir.arrpCC.pheque*QChild Hsecret8RyignONGrall>C݃WKi1le^IndiPuampb-Banner`WagiH5Admi`thaaiLltW-Mo?8s'όTlyScot(gundHaEBoaradeܘgb,s.׀ϥmyselfHw КR time`fwo Ygn :@MhStansfel@aheȥwYwدأNonu irteeable77273517171772SeesuP1M@ 306,. 677lso artHBX+May44828833Zk781x9y9o13wbidf8700ϯό526W909d>*4 23w?6485?p1q1?:`XaacasRYm 9X@DisraeliiԹolu;RiBrighѺagreXurg9thOPhouberopp(ointedؿxeQliȭhmePpunanim:vtoupport ndset aӈabXm722xargu8odɊ wQw/nhavar05 1ףon9890o33oj0P!11wu803644w J 2655zFtpesȭ8,m[Yducjobu*w unttصrom0Whitbinvix[preferlstaunimaloutќXDal!ie,truexrtsӾratcppublicPftoo (loiocxtrykbScoshIretaryship,ڤ+/ 93659p6q Andix{703508y9ir,ril omaќ)D0ȿroCIfGG35깡99//122r9Ǟp04-OO'O_20(OǾߤ6Í"35' (span>Hans.
a>td>May 15, 1886wwu7487wp3q3wrSeeornstance, Ftpoint,X@ ߦr0rfamȖ!ceed@si e-ro0FiAJc)AvoluPAكitep8 (1891)ߩߩ42396ߩ77ߩL"iT.Ȍ0oltoxM.Pݧ362288669i601o991541_21010Ice ex893iberal idag8ةͷǷǷ535811ǯω. 32ǺǺ7475߆Ѻ1ǺHe ipi91970q1wOSQBeistohdeaMessSp rJa9!Ͽω323ϓ)1/n>Cons*DpngervBy.nlؗ0007x91n>Ninethüuryanuq7PopeechtaQ@@en'seigAugu3"1reaXmemGladnetrabetwඨXstatesAKirkw0Y802671n>Ro`tsm:BatXiBIf888).publfr G__[LrPeaniֱ?1490*?d>2n1..GH9G@22ir׶`arcourHCha!l0,ordșchGeor8TrevelyaHAmyselfWW816Gi2oGesick2xtirmhh9oo78go]Baptrticle,oiFeb5'3045wٯrp1ybodyhlدf`htosin!ht`uisspisodRfi᠘detaixa}bybWiam9Derby, 27b9.ϣ/Jul@䦸 oEqns'DTmwWolxHppril 1oo3074o2Ƕn>Hans30Sept(8epos=0833722 id="note_225">(.
See UnitedrelandLord҃olphadncouragafampaignnlstergainstomeuleoo910377peechtheemorialall,uly 29ʁɇχσc5OJ8I8OJRXrt,. 8,e1q#91' 9 9 FreemanJanύ40393030Questions 16, 473-?362011>Hansugu1__'849߅22߈>Ibid&31HMar22ז 41563 3GCAprilGߙߌL70_H4I4_whnriminPLawmend t ()iLR885Qa3gcThisitfeatureYكasiscuss@Țrt,aoy tingoperaAcoears.ne 27'1013.Ԟclauserejbyh01qoajty6qGG957oA3GP@es,..,YWalsh'sse JudgsSuHiCasnd 9Procedq_15846y3Oneptemb96194W)3=p3213:??41653DecP8Ww 33s91 /_244+Mayj\854i4߯n>Table'5* //)77518/4ײliadCx_11\ xRicge~iii. 4678060iy4HoLord0WW 340WqA4GS

HeptextKonceam(iece:㼞ww8wq5ww4X)35dlepos=0911166 id="note_254">(.

Evidence56A3519288>!Triplellia`"Italy'slaIt.4yutidanosContoraReYOctoberAppendix//D4443/A9AG99, 56//500G@60@6G)irdart6287411V20AZ95؟262Y(Picla aredsGoodordsU(March-Nm9001werubsequ0lyublish`umeormndtitPImpregnabRock HoxSctur517gb3a3>SkerAug. 309.4986Ϫn>Inf{98:\WhPoesc(s!estithiributQstreams欯$6596n>Odxx. 8ww62053H6ϲMr.anburyuة?n>s33Q/W63o)!6'kAtirmingham,up GG8Y_^.gNorPrnhigru)2OO381O!!6'Balfourtͬ0XteDi(|WW591׾P7)7/S27??q6157綷Rob9ԆAPClubB1Fnjdp1625d K3PwhXnyinfиAthIr 8stionamoproPqax`largeuQelershdmitt@vi8ϡXl@beontcsaysenera,A,ikoany)ye- h been0cid(by reoyiry egxWladstonXhoa@nemselvf2pollyboggc70g8 7bDeff(pwillr(gatSParneخqaHme@tXy ,privlifmwAinkassd. 0cyexemppenaltiؙshoulpppKcaZcanssibdaavexceR*valuhiPsui+veniR|PceasHҷ@ψleaZai;jAcious aLl pposaȺig󞰝r ylieve @wh虀KpnoooulitIs s@sfaqИfeelaŞadvȿqs8biاAweim42ctthirAvacin``YunnPwithsggГ+engagDaiTiraphVNov7//586)3)3/&Retd,ecByKAn CleopatraAIvS(Y77907)4)472LranvSWParcȍ9ArnoxMorlemyf//,90926/(5)5/
Ifnybodyaresoollowllhisp,eayeadpeechfr.arnell'stˀPs,ug. 16, 1891, fureplymineenttp7.(a>td>OndaftereavingawardenXspokeLiverpool,llonancashireryir grAoldQder.SeeOAKxi. 200.ItjsicknTtpmeСme;;wylthyosseglOdysseuyle(`LbrhXHixƫ8138080HoCarm>143783511F23R807G22Al {y''{286'3 3'"Juh8w99z4ycto6.e2hy-sixy (bJup1846)sɦjpint417955Vol.ip. 38586387abovvڂڵZ747_Y rnceGlads@٢( pipsetc@ɤ q)Lnscrip#ymuiq;muHhehHtȷ furrmmemoapmarkab(friendship:eorgiormitB,bgero,.DuEWAmiceneثlforumRValeug iRג9921ע8׹

Erai',e'lisio
'aviga, nsPcuHSLHi'xnta'olci)Petcp:;PurgNviByrr0XwAenough(n|55598Mhoocca@8e:2aga!acaulay`praipassa(Barrow d53׺/-62504/_29)2/-Id<x915+ν04516348ɀ349;, i62;q60z99Ђbp2u27ӂ8@8?=A942o08127985;,3S801Rk92҇43+1€263[uAsk , pi,tombɝ,ut wnai0a.kail5770783477297d>IXHucceedJt8g7yHiry 886433 BosA,Xrh217xepeated,itheryemarkableualification,ept. 19, 1777.irkbeckill'sdiKiii.X62.

(a>td>Carm`b5߂߂98196߂5ف߂Transl"syytteltonndladshe,6φφ10203φ6Ɂd>Thouhalt sesshyouloutaremongeiving,lighterhenȂ`goestoZplacemoPoo12680oh7i7ojSeeppendix,or. 02, 2688Lordalmer10go8nmentf 1859asHoryonlypfeways855/99

HIieourCabinet:Vice-pϛϛȊ?bDxcɹJ20533_300">(MP^`spees"wٝsSie useQCn0,eb. 3kMay1893((alsCFrh٤wookQ,JM.adddetNovjб95;+"ͿL2042H1I1Iopeɺ e0ypckf8)xah"tt0eBlok@n˖#myself37022ab,𽐿0870869 >386i70603ѽd>OneoPbiographictemerhap#toa(dwillgrudgeeavIprom?<`ryOcto 6ӝئ)*imnvoyB8h@ ...u1 t.TWWS41299WP4Q4WGCii.a24)75775 5Apdixfh0elucida?<54499696?:AG 2956313015750G77Wr!nowarGGA6821GA8A8GBDrlylnsl6ϭ99KInfoxxv98'9061'_31!1'ul- `٬mwithdrawa(xrSirohnPwa`loྣychaiIQqele` ǭ/wt721w31)1/_`TPlacesSc@mMohriChupruepA83936Ы1n>L>DukWhmins=//8P/P1+Fp׺s=0001189538 id="note_314">(.

Kingohnd t>Glean߃%4_'67A3A3>Life4QOOI428Ǎ2 252!ooi62355/Pi2o+TelegrazApril ǡ64ג2ǣDetchGF5622o2$ower73ߦ/77ǘ2Ϩn>Ibid B605ٝA"d>Egypt,o3484 ( ); ' 3b2 (z30)/dl2iviveight="4em"I
4[20, 10Aordrom񐯐

Bhoulpeam11-h.html hzipp!allssociasvariouormatsiHfouin: <.g.oɗcҟPrs/3/1/7 /FUpdBtreplaceprevo:oLreratworkpublicomainiȃms@noowaniYStsopyrȕs,o2F(you!)anڗjdE?:witXtermissq9ayoroyalties.pePuetthMGenerTؐU partt(enseppXto  PctronPpr@9conceptSradek.jregxe@o3maytusifhargrBeBoounsreceiv؉f .ɂ3dolany`؊ ,Xmюqveryasy.مɅkrnear``r鯀a@"(derivd0+r.heypmod@aʀdgwbPpracticy ProjectutenbergavailableisBrnlinet http://www.g.org/l3).

S8ion 1>LBy 8dus1 partC萟indicathihave ,nderstan`&pccept4Jintelyuhproperty (trademark/copyright)3ment.fdoo8bidey瓈musteA-dturnde0oc0ie*_zr (sesspaixfbtain !y9pssjoowb`o Wwwq{reffrom{8Hi`wh膦asetPГaphȠנ404130 HE.8haX/GGBn> Qg0erntCn(usassociHanpeopyhߔTh!`wng%czmo877evenouR fwSo?<8689iCbelow?9lHQ/77folߞhelpeserf fu(Ǭϖ7004312ϴܖWOOCgOI0gݻXaryrchi`F!a(ZֻHPGLAFown9ȸ^ cP׿OoNearͱvidނ׼R)pubm1,Undt(pЛǨ''''8|lo鞢ol,eclaimɉ0Кx:I, qHmplac(!Hrivb¹o9(n(7_premoved.fursehgwisuppxRmimo?y8sharϹιvjiaw߽ߞṹkeepnamI.٪ i@S?77(Ǻ˙SsAitttachʾGFLicens!Ⱦ a#2gors7774D77埏lawD`laA?;alsorPoo.Â񹰵R`nAӤ)nsta)ngerUsidᠧ<(ckE Ryddi (ϻϏ&ehwnloadϝϞϞϞϒany77Q?ak@noHnsQc宗uƒq݃щ5wwwwsEwwqUnlha :T4210XEf`owوyaa(lintortimmedO,ϝeu@app`inP@qϵ(^whicphr Tn rˀs,rithhichhehrase Projectutenberg Th0eBooky@uofnyone9wherHtostdalmreYctionspatsoever.ouayyt,iveHwre-undeterms)'$icennclud`"twonlit1.E.2.appearb,muXcomply(requirementBparagraphs@ile=0001400555 10rough A7Zb _[^ɗtradema)setyȂ41308⤀9ߖ3ߖߖߥߖߢJ_rҔ!?ycbo9addiy{im byXA will٣Pk[a)Gfo(YYbeginnBQߥ4Dou1detamoifu' CB0s9toQd"/ڹ}Ǭ5LJ"+gL//~ntten`@//phӻX@ѫjimmج?6nP Cbinar0ir ed,rup,0n0prir`~{[(dѱDhytexm.oweгCo/ba~nlVanaSCIIְ1doffil x\DŽebx (http://www.g.orgHe,nxcP,exp;Laean˛3` eiǑBiIXl஑lHn!$Ӧpecifiha>7hargѰ,iewb¹ᗤGĽϳZ@I_7.4130+8*к98.Ureas`bl(2:Ϻέ7;hhatStsumy="TI`ast."bodyQryh>S4, Informboutons. hp>Yourovidullef`fnyoneyaidyuserhootswriting (orQe-mail)ith30aysreceip)Ps/do8greemҍGDHcense. Imustquireuch@return destro``cop,works sȎahysicalediumdisconxu@daccђor7W.,ccordanch`r@aphwt08088 >1.F.3A,(aplacemy8fyelhronicisver08ort,9/-k'complyachrQftribub73/tbodyable!divX3h4E.9hXIfshachargB0Q]/Ogroupcxdiffȧq eˆwnt,zobtaphissgom(?????BMielarYownǟtrademapÜaᬘ׬1649Jelow-ߍ3>paragraph 1.F.3,hisork @providedoou 'AS-IS,'ITHOTHERARRANTIESFNYIND,XPRESRMPLIEINCLUDINGUTTIMITEDOOJMERCHBILITY9FITNFAPURPOSE.

5X

Sometatesootllowisclaimersfertainmpliwarrantiorexclusionlimirtypfamages.fnyorsetorth 9eementiolƒlaw9IrpHcableI߁َVshe(terpretmakmaximumG+perby.ԉ@invalidityunenceabil2sυ~Yvoi@remings 6EMNYٖxindemnifydolSFoundҊ3tra@aowner,exoyJonecopfrojectutenberglronicRsaccordancei 3ɒvoluЖYassocixducmo‡(tribuMDŽDŽDŽ,armless`qp, st(expenseinЈlegaletha`rise`rplufoѐ)which򞠝cau8occur: (a)/b, (b)(modif8dГdk`ǎǂƓ(chDef¦OI?mbp:pbreak/>

S2>VgfinisuppPNJ? ye8crc@chqOM'soal$nsurj1ץcwi@cavail:@ 䙢e(001ߨiryrvaeȠH0صa8PutIz? Toarnh~/WWW<*w'canelp,e ds 3 3022 >4Ǎ3eb y http://www.pglaf.orgWWWWV3WWWW7//G__TwGoon Ⱦfit 501(3)𽘝@Pand errlawѝHtڪppigraaxHemp0`lIryRevenuyrvicpxEINfePntumh64-6221541stHygm /fais/õadtiDfuextidU.S. Z.'$p0cip8of oK4557elanDr..Fairbanks,K, 99712., GCmployees`hrough ehӍbuesQτ809εHh 1500׹,altakeity,T 8, (801) 596-1887,@.ŀcaliPup eibYוlsjbwwwrF0add`t/D:[㍘Grego B.Newby}br/Chiefxt9 Diror~gbnIȪn 4//>ˀ Informationboutonzsoherojectutenbergiteraryrchiveound*

'$ependspndannourvwithwidepreadublicpportdor1itsissofncsingnumHɂdomai;ensedork(hatereelyistribxda(ne abl8ccebyBIsrra fquipmexlud@.anymallo ($1$5,000)earticular ima`0taxxemp0tatusJJIRS.http://www.g.org/fpra8ng/eS@Q5@GFGG>Genl noNelronȵ'!pfȢ Miel xHؽYorigiأh'&ڲPabra؄7uldGA h.rirtyearxducoweBoo3nYXonetvolu@supAofj MsevRpr ,ҿ0wh8,9sub0Iunlpy(ht)i(+edhuӴ,nssL wfrsͧNEyjúsubdc2am('schቔӟgЈavanillaSCII,Zd (zipped),TMLzCocMopeo)rرx XhPGar0facilityZn-p>ThxNaǴ,owa򿯽𶗶g̹ZAXchelp͹/`sc`oklslet@k@Kg$T?w5/bodytml>ʀINDXTAGX, @000000000000D7IDXTINDXd00000000000000 "00000000000001o-m݉00000000000002oj00000000000003o000000000000004oL#À00000000000005N9+̀00000000000006Pe(׀00000000000007U 00000000000008U 00000000000009oU0000000000000A.10000000000000B_?0000000000000C0000000000000D=E0000000000000E z0000000000000F ~"00000000000010 i00000000000011 {00000000000012B00000000000013G900000000000014rځ00000000000015r(00000000000016Z00000000000017!v.00000000000018#%n00000000000019&\ǁ0000000000001A'oT0000000000001B*C<0000000000001C,ف0000000000001D0Y0000000000001E1_|ȁ0000000000001F5\ 000000000000208em 00000000000021:Sj ԁ00000000000022?= 00000000000023CG 00000000000024EXH ځ00000000000025G!5 00000000000026IVL 00000000000027L$ 00000000000028LD ꁄ00000000000029LSe 0000000000002AM95 Ё0000000000002BMn 0000000000002CM 0000000000002DN 0000000000002EN* Ӂ0000000000002FU"00000000000030U"h00000000000031V ׁ00000000000032V ⁉00000000000033V00000000000034V 00000000000035V偉00000000000036V00000000000037V.00000000000038V/ ́000000000000391O0000000000003A.0000000000003B/00000000000003Ccu0000000000003DXF0000000000003E#&0000000000003FJ/00000000000040z^00000000000041XI00000000000042!00000000000043#00000000000044A00000000000045Q@00000000000046"000000000000474D00000000000048x&00000000000049*0000000000004AI)0000000000004Bs0000000000004C 40000000000004D C00000000000004E sU0000000000004F I400000000000050 00000000000051 -?00000000000052 lt00000000000053 aA00000000000054"}00000000000055#X00000000000056|;000000000000577R0000000000005800000000000059(Q0000000000005Ayp0000000000005BjL0000000000005C6N0000000000005D,0000000000005E30000000000005FPA00000000000060300000000000061E^00000000000062$:00000000000063_*00000000000064 =00000000000065Ia00000000000066+t00000000000067600000000000068V*00000000000069)0000000000006A/^0000000000006B 00000000000006C>30000000000006Duu0000000000006Ek'0000000000006F]00000000000070p*00000000000071$00000000000072AF00000000000073 (00000000000074 0 00000000000075!9=00000000000076!x 00000000000077")00000000000078".,00000000000079"ZJ0000000000007A#)T0000000000007B#};0000000000007C$9E0000000000007D$~i0000000000007E%h*0000000000007F&000000000000080&H00000000000081&e00000000000082'A00000000000083'D*00000000000084'sw00000000000085(kq00000000000086)]N00000000000087*+00000000000088*H-00000000000089*ua0000000000008A+W)0000000000008B,0000000000008C-!#0000000000008D-Eb0000000000008E.(G0000000000008F.o]00000000000090/M8000000000000910 000000000000920E000000000000930dz000000000000941dw000000000000952[|000000000000963W0000000000000974$000000000000984-:000000000000994g0000000000009A5X0000000000009B5`:0000000000009C6 0000000000009D7$E0000000000009E7i20000000000009F8I000000000000A08gJ000000000000A1923000000000000A29e000000000000A3:000000000000A4:7000000000000A5:U'000000000000A6:}$000000000000A7;!=000000000000A8;_O000000000000A9=.000000000000AA=Gc000000000000AB>*~000000000000AC?)000000000000AD?B%000000000000AE?g 000000000000AF?tS000000000000B0CP000000000000B1Ck000000000000B2D/000000000000B3D2&000000000000B4DYf000000000000B5E?000000000000B6E[*000000000000B7FG000000000000B8FMS000000000000B9G'"000000000000BAHI.000000000000BBHx9000000000000BCI1000000000000BDIH 000000000000BEIc[000000000000BFJ>000000000000C0JX 000000000000C1Jy000000000000C2L 000000000000C3U#000000000000C4U)000000000000C5U/000000000000C6U8000000000000C7UMqypdx\egcC//cB8Bcccccccccccccccccccccccccccccccccccccccccccccccccc X"C !13QRr2Aaq"5S#4sB$DbCE(12Q!A"3B#Caq ?RQI+}݆6%Qғy+kE{um=:}r9u=u_sFZ6⛽)ɝ*..u[fGGO/a<3'^w؞-U6VwaNЄbDz,G)X:$^M/Gdk&vć&vĎ58|i_i_;|5m; Cm; Gpưma|Hrma|HX>M/M/>kÇɶ!ɶ#cXp6Ӱ$96Ӱ$wk&vć&vĎ5aNN汬8|i_i_;|5m; Cm; Gpưma|Hrma|HX>M/M/>kÇɶ!ɶ#cXp6Ӱ$96Ӱ$wk&vć&vĎ5aNN汬8|i_i_;|5m; Cm; Gpưma|Hrma|HX>M/M/>kÇɶ!ɶ#cXp6Ӱ$96Ӱ$wk&vć&vĎ5aNN汬8|i_#֥?5aZclۭ&w]t&w2fT'pc4,vnU马9[K5jiR漏c_Ы.&g$y/Mt߯Z9-^`ᚔvO6=޲U!ZjS$M;o[ź{\$)4W qpPJW^vEIpv:TT`rU+&еpmQ~^mlvR5әH0RIfHo!c&fQYyx-zP=zc-s0+weg\kyk#ElJcBv*;JO֏1Zl/303щaʕHV +Gp%Q3H#[[h3\s:rъm*N,/Ga \ڊ.UypǶżNG_bg74bFi4Q+Mdg$6$Z@ڰX8M^ŭMҩ(Kwj,Z]fMTK,r>zN' ثUkrYW^f|>U~u4e48`rxC$tzԽ/ٜ ԗB#}z4Eк9J㲿\N[3%rHf0P@UuIr2(%(b2 -C!N@ɍhcGZ5cLhC:ɫ2cGZֆMX:Ǝ2j ֆ4uV0dƎ1 &4uhdՌ1 hC&`ɍhcGZ5cLhC:ɫ2cGZֆMX:Ǝ2j ֆ4uV0dƎ1 &4uhdՌ1 hC&`ɍhcGZ5cLhC:ɫ2cGZֆMX:Ǝ2j ֆ4uV0dƎ1 &4uhdՌ1 hC&`ɍhcGZ5cLhE2j -Gd5xisҵ+>yV8ҍj55eggXֈޯj-.*KZ)STv<ܮ5XGIܟUqDf^)-j̰WFgG {}GJ6Xk Iƒ͞_cBU%7|5't|MѧORQ2Ӽ^o؏q:9· "1s"1D6c52/:D6c8lǸjeϼ^t8lǸqُp˟xqُp!ᩗ>y!Cf=S.}Cf=È{\C{ L· "1s"1D6c52/:D6c8lǸjeϼ^t8lǸqُp˟xqُp!ᩗ>y!Cf=S.}Cf=È{\C{ L· "1s"1D6c52/:D6c8lǸjeϼ^t8lǸqُp˟xqُp!ᩗ>y!Cf=S.}Cf=È{\C{ L5%|dE{M]CfK&xG_spY4]:>dy\}RLNYa*IfBԯ˫)ͼڽ3*yٗNPwssKy\c:3 3Rg|dOZ=k1Zj:Vj#spM3']ŴK'j-X͢iLj{U(> k|o}?n:SZUAUZ:1͎Wa٢+^~H.b3,Y€ Yy,ڎmGI>kKI6tWGҜ|˯1j79?M*]C0µSm6DoOo`XcojmSGK76_:gI^ynG{ə]C&RMfFfGE *( ( ( ( ( ( ( ( ( =?Q182y12 N11ʫy,ͥxu̯0~pZ*:}7v[o8`:X3A-$e;mK Cn\jPNi\ZsoNZwwS3ӐIfe#ٶp4p&Z|]J6J*[mYO9&?K~0ɶ,ٟiZՊiNnJY~H(P^c,#JYz<]C&lC[hcWM:̍s:̎3@U*       󌉌0=x'{&3ƭGi)x3KEx.n~P3T) PG:3fGA&RP>afFfGMC *P@P@P@P@P@P@Wp-9TK"ڊ7"<6۽Ur :X3A-$sN KsxNRPۗ59C8ze#WdVmj!Ɋ|TiY37N6>NuGK%q>kRoϡòKM9Qޞvpq̹y $95p;Lڇ2=Gə 25Ve  AAAAAE[JIIEe0NO)heuȲ# Kӥ4F\+ӶԹ6}P]ŴU#m5Θ霱;|u<-Ni䭕iʝucV=pUx3WT<4ӍM+sz;8$( 7!̏af95pLΞP4γ#fG]€ '<\9';,2b26۽ ,9Kh%䌹Wms_am˘ 3  q0޴o\<:+9588iOiaK.ifF2̎c  AAAAAAAܯ)L@`Kh%i o#.oj|vg<Ƈ/pWتv'8GZJ,n>js٘Sm^}v w5&34{eyܞr88{GZGq !OşAccq;/CK8 1J( OGka=7OGka=7<>.ifF#*̎c J( ( ( ( ( ( Ntf[H,2^̗c9B]񜿥^+TZ>Ybִ|ٯ Us!A{UuO~x-U6W,XIk@^]~ahV~,:Ix==jYdurxÖ;=;f=;f4TU2;% RwAB$`:X3A-$e;mT˱ӥSG.sLx^1Mjg;Y]ZkTx1̌mS8/)z}X]&ڿ#w<.2%;}QjQudNXd{>f:cڀ Vthl'6ihl'0:2,3"vKPTJVF7 Kӥ4F\+ӶM:u4rg0Ǎ5d?iiO86̖̽;V'1Gj:|O~(x;VT"e~'Gu+G' #ڏ:9Nj 1YAԥ5L٥5Lžp4ȳ̋1,`<Y o#tf[H˛zv٩c9N]qP@hN%i8C%ӴYy133hQ=CV =g_Ճ|ѥ>Z:ho#MNz 2YAե5L٥5L秜:2,3vKP! ( ndž'H  H,9Kh%䌹Wm93u*hQ9{T/Ox6jv5 .k)%f=`8++iYCw0yҲ?)oy{eP@b5Lأ |%94'Xuu aɎ136Luj<6~ь#i{Cuvu1 K: uux:<i{]cu㮱`^X]g0m/xc6u1Y K:  tx:<i{C6d1 K2)ȳ+VrPHG%y o#._b{㝊)SWP@jN^w)jviUZ;`vS^'ӟ1C\eP@f5Lء |%9k8+x /1 2 1ʳ+T tpv[H 3^*觺1٫889TM47|ɚhnh@Vϴ sh.z{c(Ɔ>˓@ =`:o3= =`:o3nsAA a\UbEYb\UbCcYblUbPXA:$u %#bGPXA:$u %#bGPXA:$u %#bGPX:$u >$u HK3GPĎ>$u HK3GPĎ4fĎCcIalH64fĎCcIalH64fĎCcIa2bE"g+V0Y@HChee䌹|Vmvhg!^.Nn1fCw'ji UkK@9D-7Gӟ/r>ǓT%Aܡ GC &g CC &r>-$B ( P $@P@@B ( Cee|Vl3g Vu"=J‚f s0;l'얡 CU>Ish4g>ceZ =`o3=^!9+.v2\h1<ÛieZ4uGXƎK6>tpu*s  )ƪ=v,-TJg}.{R8Vh^t_4Oʟ~넞ܴꍬYㅔ ,sJ2\. N *P@Y-Kqx(oy3%Էۢ8\;! Ř7Vbi@@@@@PJhѮ)ӣ]״[ـ%{:v-͡}Jǣ0%}M|U/Su88:9GMNOrD1tl|Vf_Ճ KWky_J_X%{O9o~Z1tqfK7n/G&pǓO;!^vC1o,.ӌm @@P@( $@P0tkbijj 2åc{?=+[HÙ%~͟IhM|T⳺Y:u}(U[F̆*ܼ!c,+6⛍k3/6 jUvx=ƔmmbΞ"]7{zԩ( :6u]wxӡnwP/^!5vL6-wN^cGKZQƲ٫s&v{&~UԼή?/5P@Y+Gqx-8y3ݗw#y'W<y @Y4)T(( J   B ( B!գ]c DKWmPn}Jɣ9n{:vD7,?3~.>zJ‚ַÊ4 /"C:3+]v>ʮ+}I+X2pB2 ZR[Yy0yrᇲ~>s?ƨ}7 (ʦNjWRYW>_RGWpv`[&b(Eg-Qޛ.r;ԫS zrR]G%&gч.%t˙:~|ѣ?|gϫz<ΟGn/cf.1CFg]vWF*1QYRQW$<իNIEuZyiZaQRo86m kM(2j\TֿnN[?@՛J+6m&x[Hlt!\f ƾw;ֻ/i <% d|v w[Zg2rWRMm?o/?;`ђ( Rt J/Zwma\VJI_cLҾۜlJS{}04{{nr}+9Nユ4Ҿv};gWJ7)=ҾÔ_cL +ۜlJS{}04{{nr}+9Nユ4Ҿv};gWJ7)=ҾÔ_cL +ۜlJS{}04{{nr}+9Nユ4Ҿv};gWJ7)=ҾÔ_cL +ۜlJS{}04{{nr}+9Nユ4Ҿv};gWJ7)=ҾÔ_cL +ۜlJS{}04{{nr}+9Nユ4Ҿv};gWJ7)=ҾÔ_cL +ۜlJS{}04{{nr}+9Nユ4Ҿv};gWJ7)=ҾÔ_cL +ۜlJS{}04{{nr}+9Nユ4Ҿd:,iRzۼ uL* !A[.&KCLEPթϗijIϴp_ꁳPTcrI\3҈5?N]. +gO+K}x._@jAAAAAAAAAAAAAAAAA 't[ԀM9=lV9֫ T4%؛-{Vu)~<8p'(\Wi;A?P?.eNn3igg~ܿ}"wP@P@P@9էO5bο;06A5˸m_wj qN|3AAAAAAAAAV9ӌ{YV<06A5˸Yچ$m*ө̜e`P@P@+>T6)S͵>/wv3iZwʖUZ9ioڳh0Q1Jzcr3|d֎5[=Z-Nɦ[ ;@ֳ#V՗ɛ%RcZc7غX Um4sԲ^REGR4R1Et)eo8jӥh;p5Vb';;cvCA[m %7#Cύޗ1͍~evoMx/=<#M׫TywuiBtӋEnXTWJ]Ӿ-QBѬ[HiޟIJ$+Z٭h•?9ʣƩ+l#g5*ZTMd0ҥZҥsgZ.Və{LDN;uE+Eh~M,gdQU.l3zV|CYRGK٥=ѵ`7O}M\Ɏjf97- eQz^ySyI+E]R k9yQtǨ6/.sJ^jՋ>-ŧsW3nijTwtpN%vk)C :`ֳUy!/ٛ# uPy̩)NNsg'R}w*gRStpnU'Ie0t)SNJy9qV~厍dzVl^x4{oANU[E];L~优Oo۔2ǫ7V#>x-J)&gW&RM5iQ,ttM&霴6j>i,@ Uw.}v-(=sI*pWY-I(AcM#pVug`ӊY_'+c>N\}CJS?rgQ+'6/<&S~tGOW!9z^y E=S\|UN*53/8j [m+/ (`У/@wZv2Ry$%nxNM&z2SpuVY+-]͖;Iӽ>s0N^;gbdQ3[ XϊHɆQ6LJ0֔MzB ڪ'qϭ7VZ̍VZG)x5VTTMyٜ(ĦWnesCl#C?avit۱1$"fL&W#"12F&s+1̢J8ktSmܑZ뼽 gg2i_V+YeUז,ycF')93# Lw@J QNOuuE3wBOR% ){\rWN?J>є-94,V~pT(gr:SQj*YM:fE'YjN-/,\:_#pŴGpeNz2¢y%@"p;4e,x7 RC,ޭXirfetX׋:0nTHٍj59a.#Tь}(RpY󔠖?hٵVnrNnz<ʤcEpɊ`,g2dGLP!5]0 ֳӯAX%)l?=B6,kW0[vl5B^xJr^U7ՍNu̚fSYI3̱cIv՚ 4JWK)Rgzo)VڞJq٦^8,)gtU!UWy MRnҚlש)F)ߝGԞwNy%c,YwNӥ,jPzeOԽ@zS&y/|lC9 {'N2{Lro;l=)f/= =ɞ@2v}WՐzY䰆%ڑiwՑ0>x _T7ᡀƆ )/Yپy<̽*F+ ,Ќ0B**+mlrƲ}Wxi A)9QK;J$j_eShx4eAAAAAAAAAAAAAAAwEH+;K 2H2wɽlܨP[ M^X?Bwbgfp"(Q T,!,01SMEc54vV-. R:gp]Y+%Zy~<AAAAAAAAAAAAAAAiKYNGA#$c;>1tJq_LZH fⱒR*O]\ӎ9i>yo@M.7.(bd+u%jG閊1٪Лj5`sWhU'F)]O93W'GK*8hu9FWR#k׫1ـDܯy|ԏM ZջE%u߻wJd)M{o"dm,begJB(ABъ2_/'l:ik< BqR-^|-hYoojNaK/mU%|ZwJYZ:T0**zm.ń.<*5YT/Yn˘g{v+Rjt++Wm,zE-Ӗ6aRd磓[a[+7[5]FNR2YՔ1=K)w!XFԿ_^Re!+NP+NPlNRQ vNPNPd^Q/Q/ vqFӴ9BѴ0e! Fh]]Pm.0eKz}iw uFh]]rOm.pX+ӫ.pTNpTN]]@r6_iw us=6_iw ts}2[iw:D9[iwLHL]w]m.?m.up]]=*0:4=*WZppֻֻ /Iwj]xֻUF4]jٻGaKLcbWR8W3ܦ"g9!޳5UL}%+mGMcK7>~`gĒ&/_mki8Tl#*~*^YR}+-PNъ2ܓSfJFIFC   %# , #&')*)-0-(0%()(C   (((((((((((((((((((((((((((((((((((((((((((((((((((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?=g3>*4={V?M^G} ~<%l1uOVfױɈ$#ԉ<7ߟSc͐~ :T]"k \bGcc#Ϥ_Q>M]i2h_c4":gE}5fs#Ϥ_WCK>W{}w3}"DtjIG*3cO#Ϥ_Q>M]hX=>;>MG":gE}5t94?/GLH瑩44}b04":gE}5Fm2ֺlњ>Wq6(5ӵ76mAN:ֽRhH<"ԏ/>)]Jko?o?Y(*GVտ4koQQo}[|mG>6;!Vտ4koQQo}[|mG>6;!Vտ4koQQo}[|mG>6;!U:966-Q!ȸAQUK:RPE)RJ-wbX"_IsRmsƲ8٫Vq"c?pn<[w"ͤ$mDqu&GO\5nz2VW3ɓ䟙p]VS[ IJ5YTcu/SKWFה9WF9CQU}o9WAr1cxpocwtƝGT#1Қ'"Z{}y8*4S7Q5[S1+ |!)ЅN&)QnjK L؏ß^gṾm*L}bqk/c2$QFj*iFR!)38 (2,ϲ+~6oĒvostz^KGޭ*koIΓ\A5ٟ~4aשv%3MdѓMq٣&3Ei)3Fh\Z)7U[Q=\r޾LI$Q[*&M(nx?BR#a%/r?W>+25J_5⺼~Uܑ5ҷ_k|Ju}A髟RM>aIo~j ILO"}8WQrdz=nL γ)2j3~UncͦHycwWU{S5-t jW]Ώ6MsV58ub%2*<3]&EM4X 2(ȨFML2*d+s+ lHcQ+ Sԍ/}nX}_Dh۟emvҦ|:rm5xu#ͪ9hic/$㰢C^գi%g⛷B53fχawuzઽ\^4t]KMa 躗@t뒏?SM{8\P*)faڦ'N#uv|VSȓyv #t,_Ύyv#CGȓ}_6/Nbt{F?c>/?Z=΋z-/i.0PaE-^l kjb݈ʔi?mOa>mTً=OG{tTf/?'̤O1a>]tT٣zʏm33hVb'cN2RWDJ..+gO\~?..oT#/25/ޣo:|daCOeto\?:H5Aj*Vrg!EiCv&yw +#*x}0EkޱƱ%?in]*Z6v 9ѵ/A5z߂Nt]OkZ#‡J Uzg}>gOF)SJqKZ1R-+I+F. +HV">`S[D? î º_+%tJgYXO⣎?ѿp)|Wi~<FujAly6+ $w\_񢺿|wXۤؔW(Ւ=bWŞ(BOvDZ'w5STOFNs4oIW a#;|6=Zn44fKiq/PGqZjf,p#J+i;#(T̓]깤 Ix_z|Z΁+W^QkÄ#'ξ`-<-eh&ѿ#Oq25BӂO$?z_J4q~NEvO!wgcc}durVmirҊj3í/?enQ_1*Q8+~vQ5 |sm;}ޣVK͒5Uu-B; c,=GV5)4fm::#Sx ]{4I C)5ڸd6sFk#N֭[!N}Kqa\4fjQ︐(:r{4fI-ەt닐;'O^#CIA |s Nso&XuFW7\sFj-Ƣ#$* MZ~-bStp\) sV'8 ܌syf]⾗jyn{c*=qZ#v-zG >!TV\5]1UWhCn/BKk,r5b)rNzT7#񖏥걼~1ٽkf#'z&b[ `TIG߅wtrֻwI=exkE_xc֖3~=5| BRKm.Vb&68?JwP|S=Bm-+HR`*.2cd"ݟ8 u)XpѰ T_iE\=RVQ(mb{e-v{{Ue"G#H?s8H(%Od wqW<^EDfnFMdh)]eSŦ۶7T9>XNTwjb}>VggތqOrؓWAj43evW>gޅ6&NV!>M/.V'EK6<|Y5z3S{ؿi-2fϽ7&Ry IB29CUsF}&ѧ=ҳȚ-̒ 1tp*}Ͻ%{nuCz3N&?m-[yg>R0fMxP+m<q1I+.L4ߗӃ5x݅Q_ }9*Mk4#9Q_:"}:IOUa}RFkʼ{]JmožJ]w\Kw ~ۜ^24[SD30z7{c/1#~OU|bz7{=OSN cCw4gkOSNO Y\ӿ#ӭv_ ;XZt?#íY`7{ѻ޹ZiZE{ѻ޹[tӬXwTH;Ӱՠn䟮i-k|> ɿLZJ"I#{kg.[O j3O$`Eur S1]x?C}wel}Zk1DD `=+1М}7~籗%{Yv%+=FLISAFCIS((

SuJrer.ladst('oughtshenstrokeirstellxp0lh3><#fontize="+1">IIIThre(a(r꣈@rsliHal(xiz+xhoxl6SheffiQ20-21repaquef Hػ8vi0,߸rot2Ȳfollows: 8. 19, 1890־Y appep yo-mopwimatѕԫȥ (1)w3abdxqIZ(; (2,cX7enormȭrv2sQhYru yȸlikICobh*f9de,ټKlegsaa9imXdiذty83dw钥pɢRolQel``r{e sPiJIass,waXwatch.uۼjS|elf,ЃI@aX[inz8٩ um, Ó`It'`nae_1͕xAysurpAHrsrauf"Hnԛ8yᩪ`09[pg 432] a/!NonPmfrixsuch`,exampѨ)൨.freceh,ouA'sALpNelsong!my!©cir௚pSociehQPPoZChtnowledgwJclookacks h@wograpt8narhtohWIsagu3lihbeyo Й(with8S踀gnic m0tSPewI㙈do9g(Hsцse)mismharm. HdoubtlessRunYHar{xnPl(JanyӸjle.ԋyA,!1a/(udճmripxfasHThfarY9tot`waKhsuppoPfsZo烹g1/APercZrAso(p@:unn.elؓ ػȢQtiasm,hazars(occasem+ llıeep8nXd@a@!awakxMev`viHnt`ionrimpMGladstihaӈemptoriche alliancenheeryorrowfdecree.sf,r.ladstoneimselfsedoay,touldeutyqanyarhleadertakenhisandsJlerableurdenexercisingrrigoursQinqutiH(rivateensorshipanithhom(at judg9@highestublicpedienctraw釡co-opXt/eyggc?9urhloac,ZoutivٌParnellimr؎9aksuch Qowsmervenunnecessary.hyh`HassumhlZnotecognisfڒua? Iȃmined,X/a p>T[pg 433]/p)divJPmsnreBritainTl`,RkeealivڔruhpurportRR eXHPrrgal0eir!lace(qsngjopaccu(ettpolcal=hconsi(Platpm-unitpulpitywwhirlwElect cuhfax(nˇ2رpsawa8rfrXqu0slsambЁja*tؤhiٕsSHP,Ů(mis0tyR6imsi; Pe uri yup0un Pndlhablp(ib0zbxrouɴ`WHayIvaluxhoRrgP.ndoub*proscrib0mo ir8tadmirhfiguӮuHQhpmonur񩢺؍fȔhifCeppir'!دੀHHawarddurNeekhojArnoMorl(9rx (Nov. 23):axndX[2ornaParnxss0 cMwHpinhʕ)z.[I}tii+QnowIAmyhr@dH0sonŶt-bagZ0vAoqf绹cogencaepyYx;inouxQWapemoڤeIxirׂiamPrxؔceeC8Sheffi0,Y3HacuagȨll Y!n8 reCcd@bolaldp3[pg 434],csH followzнisph2ȴɿhe"[خscȻ.ϯPbۥHs@(貢.ɴPpqCciprigIrish nyngliAXkίXworyrnteQa;ٟ1?ZHvh袘drl,iC;r oAbIŒRȳPlByex@ {/div3h3>IV]/Xget8a`Lu𱁺fnoMonday,ovember 24.arliamentasosslenheext .hreesfcabinety1886,ndhiefhip]party,XtimlibraryaLordendel'sousetÇtPGardens)essueeforeEeraleadYala@one.Ɉnouestirighbaalistbchoo@8irwnyinflictingoliticostracism iculariP0moهinncReOwhe`r;rescon`uanc`kIrish5with2s XBr(,id tvolveiHabst joll(#n cyul ubmitteoelecto{Gre?Kbt؊diff!tiesvsanguPyeP1uhrircumcxthhadeem8soom0ng,@ill midaH.ׁchR2X0 iewuuphdded?nlhclussi)up ILLhividual@R])阀chex,x٩ibetwey!b.Țٍsn ,uxtakena!;!pXw9[)bignuorsurawaian.+p>Mr.lads`ѐtxfH Йoqh@pinġqU並itsel mp ٿ0neunfi(imvqQ)ʚyٜIX, JrepuIrequirj`fobndcPʇd.La!Dqcribecaڇnqw0놺oŸtuH@Hia As?ɹHapt3mifntol𰹆.HdenhousAظHxgrq6I b `rXs,擧 ju"argueurʶ`uvotuppoauomy.owJR(me]I qQhappnam0!e`?hLshipq@es9@dsPcI)w[rk?׌aborrgrepupophP[np؀pldbottag,sxɷgoFIoẑ!WBbsolXunans JOyOlУ虨[(fus٧{fward9࣊avsighz xwdedLecsoȪxȑ4mm@GlA,(t9turaѡ0nWhoxdTsoaBfx8w`bepe?ubИ@peoI2P@ ;c@Hruȭros2:l,victo0GBriE(8drenack.²X4ЭX\n.ڍemaIs)0non 8ci@Eng)ԾPa𗠁?gBu{moYynұ[pg 436])mٻhculas,IslA8aQ|l,s fٲreLhuXpյ`s dfu pub8,ɽrmild-ey@ch toee,ndhicholiticalassionasonterestedXeepingYfulllaz@woulstantlyroputfheiHawoosteligiousommunesAworld;ratiPrsectoleratЁXeffectiverot(mpeHentffroYsJunrufflhcinuity-in8leadership. thisr(edهany؉hMr.ladstonghtprdno.ԉxlibHlUadto`sumecaxmubeIobvXParne`t everybodylsTunlessoyalgooda؄(@nolaceaalliances,qylook@Ispxaneaon.דXimsiaue mA(o(mnAҀ ?

A8 wJoretrospDtoricycauatnbeXletwri`WVrwhiWQpdecveHaphaɞkil.@mmq g8oA c0r ;mstubbornoKTw)a[pg 194]ngheirdPPq8YxatؙlJAcquiescMaw`Cor8denc)mtp`h!؜Parne%scH͠˨@.Rщy C0bhnoemp!` Ю|qeff.hXcfuxwYrriژeexceptoGranv g()ρHnghbroup (May 9)i>XicopaguplAhByrudayzoHxDW81hyearixaGorÖlpῑackcl8:ashes.LqrotbmNdipXiaubjloc8gnr#⧑I`markzfɶ0y Y iXtalIck@riqs8Ik,Onprg(dhihSme ֦knewbngn xdH`ڞl!n)ou üB")Coerc AIf;PacϰܓghyrHo`alialsalr y)𺺹뇆?On15raftI )OD(C